DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and C8orf44-SGK3

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001191102.1 Gene:C8orf44-SGK3 / 100533105 HGNCID:48354 Length:496 Species:Homo sapiens


Alignment Length:271 Identity:97/271 - (35%)
Similarity:140/271 - (51%) Gaps:23/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211
            |.|.|.|..:.|    .::.||:||.|.....|.| .:.||:|||:|..::.....:.|..|.::
Human   154 NPHAKPTDFDFL----KVIGKGSFGKVLLAKRKLD-GKFYAVKVLQKKIVLNRKEQKHIMAERNV 213

  Fly   212 QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLH 273
            ......|||:|.....:|....|:.:.::|..||||..:..   |.....|.|..|||.||.:||
Human   214 LLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLH 278

  Fly   274 NAGIIYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGHAVD 337
            :..|:|||.|||||||....|:.||||||.| .:.:...|.|.|||.:|:|||::..:||.:.||
Human   279 SIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVD 343

  Fly   338 WWALGVIACQMLTQKSPNIKR-------HLLRRRESVEPEDGLS-NAPSIAQ--INGCLQDSDGD 392
            ||.||.:..:||....|...|       ::|.:..|:.|  |:| .|.||.:  :....|:..|.
Human   344 WWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRP--GVSLTAWSILEELLEKDRQNRLGA 406

  Fly   393 SEDFLPEEVQH 403
            .||||  |:|:
Human   407 KEDFL--EIQN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 92/259 (36%)
STKc_AGC 167..>354 CDD:270693 74/190 (39%)
C8orf44-SGK3NP_001191102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 1/1 (100%)
STKc_SGK3 165..490 CDD:270755 93/260 (36%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.