DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and rskr

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_002937672.2 Gene:rskr / 100494554 XenbaseID:XB-GENE-6503675 Length:396 Species:Xenopus tropicalis


Alignment Length:327 Identity:117/327 - (35%)
Similarity:175/327 - (53%) Gaps:53/327 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VAKGAFGVVFKVSSKSDISQ--CYALKVLKKSKLIEDNSVRQIKDEADIQKVCGH--HPFIVKQI 225
            ||||:.|.|.||   .|.||  .:|:|||.|.:::..|:::|.|:|..||:   |  ||||....
 Frog    97 VAKGSLGPVLKV---LDCSQQKVFAVKVLPKGEILRRNTLKQCKEEVSIQR---HVKHPFIQGFG 155

  Fly   226 DLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENI 287
            :.||.:.:|:|:..|...|:|:|..:.   ...|:|||:..|:...|.:||:.|||:||.|.|||
 Frog   156 ESWQGQRHLYIMCSYCSFGDLYSLWSSSKCIDEDIVRLFGAELVSVLAYLHDVGIIHRDVKMENI 220

  Fly   288 LLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLTQK 352
            ||.|:.|:||||||.::.|..|.:..|:|||.:|||||:|.|.||.|:.|||:|||:...:.|.|
 Frog   221 LLDERGHLKLTDFGFARQLAFGHHAYTICGTLQYMAPEVLSGGPYNHSADWWSLGVLLFALATGK 285

  Fly   353 SPNIKRHLLRRRESVEPE-DGLSNAPSIAQINGCLQDSDGDSEDFLPEEVQH-LTHEGRDVLRKL 415
            .|            |.|| |.:|....::|.          |.| :||...| |:|    :|::|
 Frog   286 FP------------VAPERDHVSMLERVSQA----------SYD-MPEHFSHGLSH----LLKEL 323

  Fly   416 LTIEPRQRIRSVMALQRIAIYKDYNLSSKQL--------LSLSPREIIARDGIRIYEDRHFD-QL 471
            |...||.|:|.:...:....:::.:.....|        ||:...|......:.::||  || :|
 Frog   324 LCKVPRLRLRYLHQFKHHPFFRNMSFDPILLQKFPVAFVLSMRKSEAPNLPDVNLFED--FDCEL 386

  Fly   472 TN 473
            |:
 Frog   387 TD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 107/274 (39%)
STKc_AGC 167..>354 CDD:270693 84/193 (44%)
rskrXP_002937672.2 S_TKc 91..344 CDD:214567 107/279 (38%)
STKc_AGC 99..344 CDD:270693 105/277 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4106
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D307115at33208
OrthoFinder 1 1.000 - - FOG0007368
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5487
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.