DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S6KL and prkcea

DIOPT Version :9

Sequence 1:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005156350.1 Gene:prkcea / 100005075 ZFINID:ZDB-GENE-030131-8191 Length:744 Species:Danio rerio


Alignment Length:427 Identity:118/427 - (27%)
Similarity:176/427 - (41%) Gaps:85/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAELGASASDHHYHQEELYQEQQQQQ-----QQPQQ---EQPSSRRIQFQAHTNQPTQSHPPGDE 78
            |.::....||.....:::....|:::     |.|||   |.|||.  :.....:.||.   |.|:
Zfish   300 ARKIAKVLSDLGVTPDKISNSTQRRKKLTPGQDPQQSTTEAPSSE--ESDRCKSAPTS---PCDQ 359

  Fly    79 EQPVQSQQQQLSTWSLGSLSGGRLNWSFSGARNSFRHRNKATRKSLTSLHGSRRGKTQWHRPLTN 143
            .:             |..|...|...|| |..:.....:..:....|.:.|...|          
Zfish   360 AE-------------LAELESIRKALSF-GQEHKSSSSSSCSGVQSTEIEGRENG---------- 400

  Fly   144 SIFNSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDE 208
            .:.....|..|..| :....::.||:||.|.....|. ..:.||:|||||..:::|:.|.....|
Zfish   401 DLKTVQTKRMSLTD-FSFIKVLGKGSFGKVMLAELKG-TDEVYAVKVLKKDVILQDDDVDCTLTE 463

  Fly   209 ADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKITH---FSIDLVRLYIGEIALALD 270
            ..|..:...||::.:....:|.:..|..:.|||..|:|..:|..   |.....|.|..|:..||.
Zfish   464 KRILALARKHPYLTQLFCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALM 528

  Fly   271 FLHNAGIIYRDAKPENILLTEQFHIKLTDFGLSK-WLKLGANTRTMCGTFKYMAPEILCGEPYGH 334
            |||..|:||||.|.:||||..:.|.||.|||:.| .:..|..|.|.|||..|:|||||....||.
Zfish   529 FLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGP 593

  Fly   335 AVDWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPE 399
            :||||||||:..:|:..:.|                                  .:.|:||.|.|
Zfish   594 SVDWWALGVLMYEMMAGQPP----------------------------------FEADNEDDLFE 624

  Fly   400 EVQH--------LTHEGRDVLRKLLTIEPRQRIRSVM 428
            .:.|        |:.|...:|:..:|..|.:|:..|:
Zfish   625 SILHDDVLYPVWLSKEAVSILKAFMTKNPSKRLGCVV 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 90/282 (32%)
STKc_AGC 167..>354 CDD:270693 76/190 (40%)
prkceaXP_005156350.1 C2_PKC_epsilon 3..135 CDD:175981
C1_1 173..223 CDD:278556
C1_1 247..299 CDD:278556
S_TKc 415..675 CDD:214567 90/282 (32%)
STKc_nPKC_epsilon 419..739 CDD:270743 90/278 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.