DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gwl and wts

DIOPT Version :9

Sequence 1:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster


Alignment Length:485 Identity:133/485 - (27%)
Similarity:205/485 - (42%) Gaps:101/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENADATSQSDVHIDYKTPKKTHSL-IDSEQLLDKINILTTKPENHSQNAKLPTIKD-FVIIKPI 63
            :||...:.:...:...:..|:.|.: :..:..::...:|..|..|:.:..:....|. ||.:|||
  Fly   661 IENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPI 725

  Fly    64 SRGAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNALALSRSQFCVSLFYSLQSL 128
            ..||||:|.|..|.:.|..|:|:|.:||::::.:|.|:.|..||:.||.:.:.:.|.|:||.|..
  Fly   726 GVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDK 790

  Fly   129 SYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSG 193
            ..:|.||:|:.||||.|||...|.|:|..||||:||:..|:..:|:.|.:||||||||:|:...|
  Fly   791 DNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDG 855

  Fly   194 HVKLTDFGL---------SKI------DMRRDL-----EISDLINCSPNLNARTPGQLLSLTSHL 238
            |:|||||||         ||.      ..|:|.     |.|:        |...|..|       
  Fly   856 HIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSE--------NGPKPTVL------- 905

  Fly   239 SFGSEKKLNDFGSVSSGQNNGMGSVATGTSHLLQAINKHSLI-------MELSDSEGDTSLNDAE 296
               ..:::.|.                      |.:..|||:       .|:.:..|.|.|.|..
  Fly   906 ---ERRRMRDH----------------------QRVLAHSLVGTPNYIAPEVLERSGYTQLCDYW 945

  Fly   297 KTS---DSKISGVSPFFS---AEEANESITHTCTTNVNPQ----DSSSSCSFHTCNSAD--LSKC 349
            ...   ...:.|..||.:   .|...:.|....|.::.||    ..::......|.|||  |.|.
  Fly   946 SVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATDLIRRLCASADKRLGKS 1010

  Fly   350 SPPLESKD---GAAAGNA-------IPSKRRVEFVLDAAPCQGCKLAEQDSSNMATNDGKHLPKI 404
            ...::|.|   |....:.       ||..:......:..|....||...||:   .:.|..:.:.
  Fly  1011 VDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRSNDST---MSSGDDVDQN 1072

  Fly   405 DNAIEASFEFSMVRRRSVDERNRISKGPED 434
            |......|||:.  ||..|:     |.|.|
  Fly  1073 DRTFHGFFEFTF--RRFFDD-----KQPPD 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 82/223 (37%)
S_TKc 57..>205 CDD:214567 72/156 (46%)
PKc_like <655..835 CDD:304357
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 116/403 (29%)
S_TKc 719..1020 CDD:214567 106/340 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.