Sequence 1: | NP_524860.2 | Gene: | gwl / 45969 | FlyBaseID: | FBgn0260399 | Length: | 846 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732113.3 | Gene: | Akt1 / 41957 | FlyBaseID: | FBgn0010379 | Length: | 611 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 71/207 - (34%) |
---|---|---|---|
Similarity: | 118/207 - (57%) | Gaps: | 12/207 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MENADATSQSDVHIDYKTPKKTHSLIDSEQLLDKINILTTKPENHSQNAKLPTIKDFVIIKPISR 65
Fly 66 GAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNALALSRSQFCVSLFYSLQSLSY 130
Fly 131 VYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSGHV 195
Fly 196 KLTDFGLSKIDM 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gwl | NP_524860.2 | STKc_MASTL | 52..>255 | CDD:270761 | 62/156 (40%) |
S_TKc | 57..>205 | CDD:214567 | 59/147 (40%) | ||
PKc_like | <655..835 | CDD:304357 | |||
Akt1 | NP_732113.3 | PH_PKB | 105..214 | CDD:269947 | |
PH | 107..211 | CDD:278594 | |||
S_TKc | 266..523 | CDD:214567 | 61/151 (40%) | ||
STKc_PKB | 270..590 | CDD:270723 | 60/147 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24356 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |