DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gwl and Akt1

DIOPT Version :9

Sequence 1:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster


Alignment Length:207 Identity:71/207 - (34%)
Similarity:118/207 - (57%) Gaps:12/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENADATSQSDVHIDYKTPKKTHSLIDSEQLLDKINILTTKPENHSQNAKLPTIKDFVIIKPISR 65
            |..::.|..:||.:         :.|..::|.::.::..|  ..:|...|..|:::|..:|.:.:
  Fly   221 MTPSEQTDMTDVDM---------ATIAEDELSEQFSVQGT--TCNSSGVKKVTLENFEFLKVLGK 274

  Fly    66 GAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNALALSRSQFCVSLFYSLQSLSY 130
            |.||||.| .:...:.:|:|||:::|..:|.|:.|:..:||...|..:...|.:||.||.|:...
  Fly   275 GTFGKVIL-CREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDR 338

  Fly   131 VYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSGHV 195
            :..||:|:.||:|...|:....|.|...|||.||::.||.|||..||::||:|.:|:||...||:
  Fly   339 LCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHI 403

  Fly   196 KLTDFGLSKIDM 207
            |:.||||.|.|:
  Fly   404 KVADFGLCKEDI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 62/156 (40%)
S_TKc 57..>205 CDD:214567 59/147 (40%)
PKc_like <655..835 CDD:304357
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947
PH 107..211 CDD:278594
S_TKc 266..523 CDD:214567 61/151 (40%)
STKc_PKB 270..590 CDD:270723 60/147 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.