DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gwl and CG32944

DIOPT Version :10

Sequence 1:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_788574.3 Gene:CG32944 / 40560 FlyBaseID:FBgn0052944 Length:576 Species:Drosophila melanogaster


Alignment Length:196 Identity:65/196 - (33%)
Similarity:104/196 - (53%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PKKTHSLIDSEQLLDKINILTTKPENHSQ----------NAKLPTIKD-FVIIKPISRGAFGKVF 72
            |::...||   |::.|.:     ||:||.          .:.:|...| |.|::.|.:|:||||.
  Fly   110 PRQRLQLI---QIIPKFH-----PEDHSLAMGHMLCVKCQSLIPINFDHFQILRAIGKGSFGKVC 166

  Fly    73 LGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNALALSRSQFCVSLFYSLQSLSYVYLVMEY 137
            :..| .|:..|:|:|.:.:|....:..:..||.|...|:.....|.|:|::|.|....:::|.:.
  Fly   167 IVQK-RDTGILYAMKYVSRSACEMRGALGGVIKEVELLSSLEHPFLVNLWFSFQDEEDLFMVCDL 230

  Fly   138 MVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRDIKPDNMLLSSSGHVKLTDFGL 202
            :.||||:..|.....|.|.:....|.|:..||:||..:.:|||||||||:||..:||..||||.:
  Fly   231 LTGGDLRYHLQNRVEFSEQSVALLVCELGSALEYLQANRVVHRDIKPDNILLDDAGHAHLTDFNI 295

  Fly   203 S 203
            :
  Fly   296 A 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gwlNP_524860.2 Protein Kinases, catalytic domain 52..>255 CDD:473864 56/153 (37%)
Protein Kinases, catalytic domain <655..835 CDD:473864
CG32944NP_788574.3 STKc_Yank1 150..410 CDD:270730 54/148 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.