DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gwl and Pkn

DIOPT Version :9

Sequence 1:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001097237.1 Gene:Pkn / 35950 FlyBaseID:FBgn0020621 Length:1501 Species:Drosophila melanogaster


Alignment Length:219 Identity:70/219 - (31%)
Similarity:117/219 - (53%) Gaps:20/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ADATSQSDVHIDYKTPKKTHSLIDSEQLLDKINIL------------TTKPENHSQNAKLPTIKD 56
            |.|.:.:.|   |.....|.|..:.:|...:.|:.            |.:......||.:.::.:
  Fly  1112 AKAAAAASV---YSPSSSTTSNSNQQQQQQRRNVARGLQYRESGGLETGRAGKQPPNAGMLSMDN 1173

  Fly    57 FVIIKPISRGAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQVITERNALALS---RSQFC 118
            |.::..:.||.||||.|....::: :.:|||.::|.::|.::.|..:::|:....::   |..|.
  Fly  1174 FRLLSVLGRGHFGKVILSQLRSNN-QYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFL 1237

  Fly   119 VSLFYSLQSLSYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIVHRDIK 183
            |:|:...|:..:|..||||..||||...:.. ..|.||.|.||.|.:|:.|||||::.|::||:|
  Fly  1238 VNLYSCFQTEQHVCFVMEYAAGGDLMMHIHT-DVFLEPRAVFYAACVVLGLQYLHENKIIYRDLK 1301

  Fly   184 PDNMLLSSSGHVKLTDFGLSKIDM 207
            .||:||.:.|:||:.||||.|..|
  Fly  1302 LDNLLLDTEGYVKIADFGLCKEGM 1325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 59/159 (37%)
S_TKc 57..>205 CDD:214567 57/150 (38%)
PKc_like <655..835 CDD:304357
PknNP_001097237.1 HR1_PKN_1 131..194 CDD:212012
HR1_PKN_2 243..309 CDD:212013
HR1_PKN_3 340..414 CDD:212015
C2 530..611 CDD:301316
STKc_PKN 1174..1499 CDD:270741 59/154 (38%)
S_TKc 1174..1433 CDD:214567 59/154 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.