DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aly and ALY2

DIOPT Version :9

Sequence 1:NP_001261348.1 Gene:aly / 45960 FlyBaseID:FBgn0004372 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001030643.1 Gene:ALY2 / 819702 AraportID:AT3G05380 Length:1052 Species:Arabidopsis thaliana


Alignment Length:438 Identity:99/438 - (22%)
Similarity:157/438 - (35%) Gaps:100/438 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KPRKMVAAWQNDELFIKRPNFAPRIRISEKPEIQGRIKPGVASKRTENFTKKPSNISVDVSEDEK 106
            |..|.|.|.  :|..|......|.:.|...|:......|...|::..|..||    |:..|..||
plant   532 KQMKTVKAL--EESAITSDKKRPGMDIVASPKQVSDSGPTSLSQKPPNRRKK----SLQKSLQEK 590

  Fly   107 AKEKE-------KEQDPYSNDFILGKRLYNFLKYLSSHRWIWCEFVDSFLDKPTLTMGYDMKRFI 164
            ||..|       ..:.....:.:|..:|...|.:..:.|....|:..|.:|.|    .:....|:
plant   591 AKSSETTHKAARSSRSLSEQELLLKDKLATSLSFPFARRRCIFEWFYSAIDHP----WFSKMEFV 651

  Fly   165 --AEYCPLLHSCFMPRRGWQLVRRNMGKARRFSAAFIELEREELECQRRIVRQLQQHKFNPKENV 227
              ..:..|.|...:.|..|.:::.::|:.||||..|:..|||:|:..|..||     |...:...
plant   652 DYLNHVGLGHIPRLTRLEWSVIKSSLGRPRRFSERFLHEEREKLKQYRESVR-----KHYTELRT 711

  Fly   228 GYLDQIPKRVPLPLAKDATVSSFLHGNSFEGIVNGTVMGYDPQDYTYLVRFNRNDNAVVLSLPDS 292
            |..:.:|..:..|||....|.: :|..:.| |.:|.::..|......|.    :|..|       
plant   712 GAREGLPTDLARPLAVGNRVIA-IHPKTRE-IHDGKILTVDHNKCNVLF----DDLGV------- 763

  Fly   293 QLYSDEETAAV-PLSIIMRG--NKSSSVISESAKTEKFGNKRYTKELLESVL--RVGKLQDVKHK 352
            :|..|.:...: ||..:..|  .:....:|...:.:..||    ..|..|||  ..| |::|...
plant   764 ELVMDIDCMPLNPLEYMPEGLRRQIDKCLSMKKEAQLSGN----TNLGVSVLFPPCG-LENVSFS 823

  Fly   353 ILMDLARMNEDFETFKEIGSSSSRRDAKVTPQRENLQRRYSASMIT--LH-RVNADILEPLRILH 414
                   ||....                           ...||.  || :|:::...|.:..|
plant   824 -------MNPPLN---------------------------QGDMIAPILHGKVSSNTSSPRQTNH 854

  Fly   415 DYLVEYQKQDEEEESKRGRPASEVYQKCRMQAEQDLKTAADEKFLKIE 462
            .|:..|.|..|.|                :|..|.|:.|.|||.::.|
plant   855 SYITTYNKAKEAE----------------IQRAQALQHALDEKEMEPE 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alyNP_001261348.1 DIRP 147..252 CDD:284095 28/106 (26%)
ALY2NP_001030643.1 MCPVI <481..585 CDD:281051 15/58 (26%)
DIRP 636..736 CDD:284095 28/109 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21689
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.