DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and GLC7

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_011059.3 Gene:GLC7 / 856870 SGDID:S000000935 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:141/300 - (47%)
Similarity:197/300 - (65%) Gaps:14/300 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECN--------QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65
            |:|..|::|.|..        .|.|.::|.||.||:.|..|:..:.|::.|:.:|||:|||::||
Yeast     7 DVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDL 71

  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            :.||..||..|::||||:|||||||..|:||:.||:|.|::|.|...|||||||...|.::||||
Yeast    72 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFY 136

  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195
            |||.|:| |..:||.|||.|:.||:.|::|.:|||:||||||.::|::.||.:.|..::|..|.:
Yeast   137 DECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLL 200

  Fly   196 CDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTI 259
            ||||||||| |..||..:.||..:|||.|:...|.....:.|:.||||:|.:||.:...|.:||:
Yeast   201 CDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTL 265

  Fly   260 FSAPNYCYRCGNQAALMELDDSLKFSFLQFDPA----PRR 295
            |||||||....|..|:|.:|:||..||....||    ||:
Yeast   266 FSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQKSLPRQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 139/296 (47%)
GLC7NP_011059.3 MPP_PP1_PPKL 7..297 CDD:277359 137/290 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.