DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PPZ2

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_010724.1 Gene:PPZ2 / 852046 SGDID:S000002844 Length:710 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:130/295 - (44%)
Similarity:181/295 - (61%) Gaps:15/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQL-----------NECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQF 62
            |:|:.|::|           |.|  |..:::..:|.||:|:...:..:.|:...|.:.||||||:
Yeast   397 DIDEIIQRLLDAGYAAKRTKNVC--LKNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQY 459

  Fly    63 HDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVY 127
            .||:.||...|..|..||||:|||||||..|:||:.||:..|::|.|...:||||||...:|:||
Yeast   460 ADLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVY 524

  Fly   128 GFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHE 192
            ||||||.|:. |..:||.|.|.|:.|||.|:|.|:|||:||||||.::|:|.||.:.|..:||..
Yeast   525 GFYDECKRRC-NIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDF 588

  Fly   193 GPMCDLLWSDPDDRGG-WGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNV 256
            |.:.|||||||.|... |..:.||..:.:.:.....|.|..|..||.|||.:|.:||.:.:||::
Yeast   589 GLINDLLWSDPTDSSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSL 653

  Fly   257 VTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDP 291
            ||:|||||||....|..|:|.:.:.|..||...||
Yeast   654 VTVFSAPNYCGEFDNWGAVMTVSEGLLCSFELLDP 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 130/295 (44%)
PPZ2NP_010724.1 MPP_PP1_PPKL 397..688 CDD:277359 128/293 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.