DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PP2A-1

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_176192.1 Gene:PP2A-1 / 842276 AraportID:AT1G59830 Length:306 Species:Arabidopsis thaliana


Alignment Length:301 Identity:240/301 - (79%)
Similarity:275/301 - (91%) Gaps:0/301 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGG 73
            |||:.||||.||..|.|..|:.|||:||.||.:|.|||.||||||||||:||||:||:|||||||
plant     6 DLDRQIEQLMECKPLGEADVKILCDQAKAILVEEYNVQPVKCPVTVCGDIHGQFYDLIELFRIGG 70

  Fly    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYG 138
            .:||||||||||||||||||||||:||||||||||:|:|||||||||||||||||||||||||||
plant    71 NAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQITQVYGFYDECLRKYG 135

  Fly   139 NANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP 203
            ||||||||||||||||||||::.|:||||||||||:|:||:||:|||:|||||||||||||||||
plant   136 NANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSLDRIQEVPHEGPMCDLLWSDP 200

  Fly   204 DDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268
            |||.|||||||||||||||||:..||:.|||:|:||||||||||||||.::||||:|||||||||
plant   201 DDRCGWGISPRGAGYTFGQDIATQFNHNNGLSLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYR 265

  Fly   269 CGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTRRTPDYFL 309
            |||.||::|:.:.::.:|||||||||:.||..||:||||||
plant   266 CGNMAAILEIGEKMEQNFLQFDPAPRQVEPDTTRKTPDYFL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 227/283 (80%)
PP2A-1NP_176192.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 227/283 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 371 1.000 Domainoid score I175
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37660
Inparanoid 1 1.050 534 1.000 Inparanoid score I274
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - otm2679
orthoMCL 1 0.900 - - OOG6_100547
Panther 1 1.100 - - O PTHR45619
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X621
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.