DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PPX2

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001330655.1 Gene:PPX2 / 835619 AraportID:AT5G55260 Length:346 Species:Arabidopsis thaliana


Alignment Length:344 Identity:193/344 - (56%)
Similarity:243/344 - (70%) Gaps:43/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGG 73
            |||:.||||..|..|.|::|:.||.||.|||.:|||||.|..|||:|||:||||:|:.|||::||
plant     3 DLDKQIEQLKRCEALKESEVKALCLKAMEILVEESNVQRVDAPVTICGDIHGQFYDMKELFKVGG 67

  Fly    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALK---------------------------------- 104
            ..|.|||||:||:||||:|||||..||:|||                                  
plant    68 DCPKTNYLFLGDFVDRGFYSVETFLLLLALKVIINSPTVVYFGLCKEMNELDGLLCKWVLGSLNF 132

  Fly   105 -------VRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQ 162
                   |||.:|||::||||||||||||||||||||||||:.|||:|.||:||||.|:|||:.:
plant   133 GYFLHSQVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVNVWRYCTDIFDYLSLSALVENK 197

  Fly   163 IFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDD-RGGWGISPRGAGYTFGQDISE 226
            |||:||||||:|.:||.|||:||.|||||:|.|||||||||:| ..|||:||||||:.||..:..
plant   198 IFCVHGGLSPAIMTLDQIRAIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVT 262

  Fly   227 TFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDP 291
            :||::|.:..:.||||||||||.|..:..:||::|||||||||||.||::|||::|...|..||.
plant   263 SFNHSNNIDYICRAHQLVMEGYKWMFNSQIVTVWSAPNYCYRCGNVAAILELDENLNKEFRVFDA 327

  Fly   292 APRRGEPHVTRR-TPDYFL 309
            ||:.....:.:: .|||||
plant   328 APQESRGALAKKPAPDYFL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 186/325 (57%)
PPX2NP_001330655.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.