DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PP5.2

DIOPT Version :10

Sequence 1:NP_476805.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001031534.1 Gene:PP5.2 / 818881 AraportID:AT2G42810 Length:538 Species:Arabidopsis thaliana


Alignment Length:268 Identity:112/268 - (41%)
Similarity:162/268 - (60%) Gaps:10/268 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KAKEILSKESNVQEVKCP----VTVCGDVHGQFHDLMELFRIGGKSPDTN-YLFMGDYVDRGYYS 93
            :.::||....::.::..|    :||||||||||:||:.:|.:.|...:.| |||.||:||||.:|
plant   255 QTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFS 319

  Fly    94 VETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTAL 158
            ||.:..|.|.|......|.:.||||||:.:.::|||..|...|.....| ..|.::|.||||..:
plant   320 VEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGEVRSKLSEKFV-DLFAEVFCYLPLAHV 383

  Fly   159 VDGQIFCLHGGLSPSID--SLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFG 221
            ::|::|.:||||. |:|  .|..|||:||..|.|.||.||:||||||....|.|.|.||.|.:||
plant   384 INGKVFVVHGGLF-SVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFG 447

  Fly   222 QDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELD-DSLKFS 285
            .|:::.|...|.|.|:.|:|::..|||...||..::|:|||||||.:.||:.|.:..: ..:|.:
plant   448 GDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKLITVFSAPNYCDQMGNKGAFIRFEAPDMKPN 512

  Fly   286 FLQFDPAP 293
            .:.|...|
plant   513 IVTFSAVP 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_476805.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 111/266 (42%)
PP5.2NP_001031534.1 PLN03088 13..>155 CDD:215568
TPR repeat 13..41 CDD:276809
TPR repeat 46..76 CDD:276809
TPR repeat 81..109 CDD:276809
MPP_PP5_C 216..531 CDD:277362 112/268 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.