DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PP2A-3

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_565974.1 Gene:PP2A-3 / 818850 AraportID:AT2G42500 Length:313 Species:Arabidopsis thaliana


Alignment Length:303 Identity:243/303 - (80%)
Similarity:270/303 - (89%) Gaps:0/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRI 71
            |.|||:.|.||.:|..|:|.|||.||:||||||..|||||.||.|||:|||:|||||||.|||||
plant    11 TIDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRI 75

  Fly    72 GGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRK 136
            ||..|||||||||||||||||||||||||||||:||.:|||||||||||||||||||||||||||
plant    76 GGMCPDTNYLFMGDYVDRGYYSVETVTLLVALKMRYPQRITILRGNHESRQITQVYGFYDECLRK 140

  Fly   137 YGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWS 201
            ||||||||.|||||||.||||||:.:||||||||||||::||:||..||:|||||||||||||||
plant   141 YGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDNIRNFDRVQEVPHEGPMCDLLWS 205

  Fly   202 DPDDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYC 266
            |||||.|||||||||||||||||||.||:||.|.|::|||||||:||||.|::.|||||||||||
plant   206 DPDDRCGWGISPRGAGYTFGQDISEQFNHTNNLKLIARAHQLVMDGYNWAHEQKVVTIFSAPNYC 270

  Fly   267 YRCGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTRRTPDYFL 309
            |||||.|:::|:||....:|:||:||||||||.||||||||||
plant   271 YRCGNMASILEVDDCRNHTFIQFEPAPRRGEPDVTRRTPDYFL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 225/283 (80%)
PP2A-3NP_565974.1 MPP_PP2A_PP4_PP6 13..297 CDD:277360 225/283 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1940
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100547
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.