DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and ppp4cb

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001104638.1 Gene:ppp4cb / 562705 ZFINID:ZDB-GENE-080219-32 Length:307 Species:Danio rerio


Alignment Length:303 Identity:197/303 - (65%)
Similarity:244/303 - (80%) Gaps:3/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGG 73
            |||:.|:||..|..:.|.:|:.||.||:|||.:|||||.|..|||||||:||||:||.||||:||
Zfish     6 DLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGG 70

  Fly    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYG 138
            ..|:||||||||:||||:|||||..||:||||||.:|||::||||||||||||||||||||||||
Zfish    71 DVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135

  Fly   139 NANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP 203
            :..||:|.|::||||.|:|::||:|||:||||||||.:||.||.:||.|||||:|||||||||||
Zfish   136 SVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDP 200

  Fly   204 DDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268
            :|..|||:|||||||.||.|:...||..|.:.::.||||||||||.|..:..|:|::||||||||
Zfish   201 EDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYR 265

  Fly   269 CGNQAALMELDDSLKFSFLQFDPAPR--RGEPHVTRRTPDYFL 309
            |||.||::|||:.|:..|:.|:.||:  ||.|. .:...||||
Zfish   266 CGNVAAILELDEHLQKEFIIFEAAPQETRGIPS-KKPVADYFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 188/283 (66%)
ppp4cbNP_001104638.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 188/283 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.