DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PPP5C

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_016882424.1 Gene:PPP5C / 5536 HGNCID:9322 Length:551 Species:Homo sapiens


Alignment Length:317 Identity:124/317 - (39%)
Similarity:185/317 - (58%) Gaps:27/317 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDKATT----KDLDQWIEQLNECNQLTETQVRTLCDKAKEILSK-----ESNVQEVKCPVTVCG 56
            :||...|    |:|.||.:...:.::....|:..   :.||:|||     |:.::|.: .:||||
Human   181 LEDGKVTISFMKELMQWYKDQKKLHRKCAYQILV---QVKEVLSKLSTLVETTLKETE-KITVCG 241

  Fly    57 DVHGQFHDLMELFRIGGKSPDTN-YLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES 120
            |.||||:||:.:|.:.|...:|| |:|.||:||||.:|||.:..|...|:.|.:...:||||||:
Human   242 DTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHET 306

  Fly   121 RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGL-SPSIDSLDHIRALD 184
            ..:.|:|||..|...|| .|.:::.|:::|::|||...::|::..:|||| |....:||.||.::
Human   307 DNMNQIYGFEGEVKAKY-TAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIE 370

  Fly   185 RLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYN 249
            |.::.|..|||||||||||..:.|..||.||....||.|:::.|...|.|..:.|:|::..|||.
Human   371 RNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYE 435

  Fly   250 WCHDRNVVTIFSAPNYCYRCGNQAALMELDDS-LKFSFLQFD----------PAPRR 295
            ..|....||:|||||||.:.||:|:.:.|..| |:..|.||.          |.|.|
Human   436 VAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVVSHPSGPLPLPSR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 118/301 (39%)
PPP5CXP_016882424.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.