DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PPP3CB

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001135825.1 Gene:PPP3CB / 5532 HGNCID:9315 Length:525 Species:Homo sapiens


Alignment Length:277 Identity:118/277 - (42%)
Similarity:165/277 - (59%) Gaps:16/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVE 95
            :.::...||.:|..:.||:.|:|||||:||||.|||:||.:||...:|.|||:||||||||:|:|
Human    73 IINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIE 137

  Fly    96 TVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVD 160
            .|..|..||:.|...:.:||||||.|.:|:.:.|..||..|| :..|::...:.||.|||.||::
Human   138 CVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYEACMEAFDSLPLAALLN 201

  Fly   161 GQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISP--------RGAG 217
            .|..|:||||||.|.:||.||.|||.:|.|..|||||||||||.:..|...|.        ||..
Human   202 QQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCS 266

  Fly   218 YTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDR------NVVTIFSAPNYCYRCGNQAALM 276
            |.:.......|...|.|..:.|||:....||......      :::||||||||.....|:||::
Human   267 YFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVL 331

  Fly   277 ELDDSLKFSFLQFDPAP 293
            :.:::: .:..||:.:|
Human   332 KYENNV-MNIRQFNCSP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 117/275 (43%)
PPP3CBNP_001135825.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
MPP_PP2B 50..354 CDD:277361 118/277 (43%)
Catalytic. /evidence=ECO:0000305 65..356 118/277 (43%)
SAPNY motif. /evidence=ECO:0000250|UniProtKB:Q08209 316..320 3/3 (100%)
Calcineurin B binding. /evidence=ECO:0000269|PubMed:26794871 357..379
Calmodulin-binding. /evidence=ECO:0000269|PubMed:26794871 402..416
Autoinhibitory segment. /evidence=ECO:0000269|PubMed:26794871 417..424
Autoinhibitory domain. /evidence=ECO:0000269|PubMed:26794871 475..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.