DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and ppp6c

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001017110.1 Gene:ppp6c / 549864 XenbaseID:XB-GENE-1017127 Length:305 Species:Xenopus tropicalis


Alignment Length:313 Identity:173/313 - (55%)
Similarity:217/313 - (69%) Gaps:24/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGG 73
            |||:::|...:|..|.|..::.|||...::|.:|||||.|..|||||||:||||:||.||||.||
 Frog     5 DLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGG 69

  Fly    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYG 138
            :.|||||:||||:|||||||:||.|.|:|||.::.:|||:||||||||||||||||||||..|||
 Frog    70 QVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYG 134

  Fly   139 NANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP 203
            |||.|:|.|.:||.|.:.||:|.||.|:||||||.|.:||.||.::|.||:||:|..|||:||||
 Frog   135 NANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDP 199

  Fly   204 DDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268
            :|...|.|||||||:.||..::..|.:.|.|.|:.||||||.|||.:..|..:||::||||||||
 Frog   200 EDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYR 264

  Fly   269 CGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTRRTPD------------YFL 309
            |||.|::|...|            ....||.:.|..||            |||
 Frog   265 CGNIASIMVFKD------------VNTREPKLFRAVPDSERVIPPRTTTPYFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 165/283 (58%)
ppp6cNP_001017110.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 168/295 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.