DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PPEF1

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001364915.1 Gene:PPEF1 / 5475 HGNCID:9243 Length:653 Species:Homo sapiens


Alignment Length:352 Identity:105/352 - (29%)
Similarity:155/352 - (44%) Gaps:64/352 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKC----PVTVCGDVHGQFHDLM 66
            |..|:|..:|...|...|....|..:..:.|::|.:..|...::.    .||:|||:||:..||.
Human   117 TCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLF 181

  Fly    67 ELFRIGGKSPDTN-YLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            .:|...|...:.| |:|.||:||||..|:|.:.:|....:.|...:.:.|||||...:...|||.
Human   182 LIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFT 246

  Fly   131 DECLRKY--GNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSID------------------ 175
            .|.|.||  ....:.:...:.:.:||:..:||.:|..:|||:|.:.|                  
Human   247 KEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIP 311

  Fly   176 ----SLDH------------IRALDRLQE--------VPHE-GPMCDLLWSDPDDRGGWGISP-- 213
                :.||            ..|..|::.        ..|| ..:.|:|||||  ||..|..|  
Human   312 PTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP--RGKNGCFPNT 374

  Fly   214 -RGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALME 277
             ||.|..||.|::....|...|.::.|:|:...|||..|||..|||||||.||.....|:.|.::
Human   375 CRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIK 439

  Fly   278 LDDSLKFSFLQFDPAPRRGEPHVTRRT 304
            |.......|.|:         .||:.|
Human   440 LCSGTTPRFFQY---------QVTKAT 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 101/336 (30%)
PPEF1NP_001364915.1 IQ 18..37 CDD:197470
MPP_RdgC 115..452 CDD:277364 102/345 (30%)
Catalytic 121..455 101/344 (29%)
EF-hand_7 568..636 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.