DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PPEF2

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_006230.2 Gene:PPEF2 / 5470 HGNCID:9244 Length:753 Species:Homo sapiens


Alignment Length:419 Identity:109/419 - (26%)
Similarity:163/419 - (38%) Gaps:136/419 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDKATTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVK-C---PVTVCGDVHGQ 61
            :.|.||.     .:|......||....|..|..:.|:.|.:..|:..|. |   .:|||||:|||
Human   124 LPDHATA-----LVEAFRLKQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQ 183

  Fly    62 FHDLMELF-RIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQ 125
            ..||:.:| :.|..||:.:|:|.||:||||..|||.:.:|.|..:.|.:...:.|||||...:..
Human   184 LDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNL 248

  Fly   126 VYGFYDECLRKY--GNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLS--PSIDSLDHI------ 180
            .|||..|.:.||  ....:.:...|:|.:|||..|:|.::..||||:|  ..::.||.|      
Human   249 RYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIV 313

  Fly   181 --------------------------------------RAL---------------DRLQEVPHE 192
                                                  |:|               .|...:|..
Human   314 STMRCKTRQKSEKQMEEKRRANQKSSAQGPIPWFLPESRSLPSSPLRLGSYKAQKTSRSSSIPCS 378

  Fly   193 GPM-------------------C-----------------------------------------D 197
            |.:                   |                                         |
Human   379 GSLDGRELSRQVRSSVELELERCRQQAGLLVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVD 443

  Fly   198 LLWSDPDDRGGWGISP-RGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFS 261
            :|||||..:.|...:. ||.|..||.|:::.......:..:.|:|:...|||.:||:|.|:||||
Human   444 ILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFS 508

  Fly   262 APNYCYRCG-NQAALMELDDSLKFSFLQF 289
            |.|| |..| |:.|.::|..:|....:|:
Human   509 ASNY-YEVGSNRGAYVKLGPALTPHIVQY 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 106/411 (26%)
PPEF2NP_006230.2 MPP_RdgC 122..537 CDD:277364 109/419 (26%)
Catalytic 128..540 108/415 (26%)
PP2Ac 141..540 CDD:197547 104/397 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..382 5/63 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..435 0/25 (0%)
EFh 657..722 CDD:238008
EF-hand_7 657..721 CDD:290234
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..753
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.