DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PpD6

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster


Alignment Length:265 Identity:128/265 - (48%)
Similarity:174/265 - (65%) Gaps:2/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYV 87
            |.|::|..||..|:|:...|..:..|..|:.|.||:||||:||:::....|..|.|.|||:||||
  Fly    52 LLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYV 116

  Fly    88 DRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDY 152
            |||..||||:|||:||:|::.:.|.:|||||||:.:.:||||:|||.|:| ...:||.|.|.::.
  Fly   117 DRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKTFVDCYNC 180

  Fly   153 LPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDDRG-GWGISPRGA 216
            :|:.|::..:|||.||||||.:..|.:|.::.|..|||..|.:|||||||||..| ||..|.||.
  Fly   181 MPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGV 245

  Fly   217 GYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDDS 281
            .|.:|:|:.|.|...|...||.||||:|.:||.:...|.:||:|||||||....|..|.|.:|..
  Fly   246 SYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKD 310

  Fly   282 LKFSF 286
            |..||
  Fly   311 LVISF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 128/265 (48%)
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 128/265 (48%)
PP2Ac 54..315 CDD:197547 125/261 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.