DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PpY-55A

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster


Alignment Length:288 Identity:126/288 - (43%)
Similarity:180/288 - (62%) Gaps:8/288 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TTKDLDQWIEQL-----NECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65
            ||.::|..|::|     :||. |.|..:..|..:.:|::..:..:.|::.||.:|||:||||.||
  Fly     5 TTHEIDCIIKELTSLNGSECT-LKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDL 68

  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            :.:|:..|..|..||||:|||||||..|:||:.||.|.||:|.....:|||||||..|.::||||
  Fly    69 LRIFKACGFPPKANYLFLGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFY 133

  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195
            ||..|:: ...:|..|||.|::||:.|||..:|||.|||||||:.:|..|..:.|..::|.||.|
  Fly   134 DEIKRRH-TVRLWHSFTDCFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIM 197

  Fly   196 CDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTI 259
            |||||:|.: ...|||.:.||..:||.:.|...|.....|.|:.|||::|.:||.:..:|.:||:
  Fly   198 CDLLWADLNHTTKGWGHNDRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTV 262

  Fly   260 FSAPNYCYRCGNQAALMELDDSLKFSFL 287
            |||||||....|...:|.:...|..||:
  Fly   263 FSAPNYCGMMNNAGGVMSVSTDLICSFV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 124/285 (44%)
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 124/285 (44%)
MPP_PP1_PPKL 8..294 CDD:277359 124/285 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.