DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Pp4-19C

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:303 Identity:195/303 - (64%)
Similarity:243/303 - (80%) Gaps:3/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGG 73
            |||:.||||..|..:.|.:|:.||.||:|||.:|.|||.|..|||||||:||||:||.|||::||
  Fly     6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70

  Fly    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYG 138
            ..|:.|||||||:||||||||||..||:||||||.:|||::||||||||||||||||||||||||
  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135

  Fly   139 NANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP 203
            :..||:|.|::||||.|:|::||:|||:||||||||..||.||::||.|||||:|||||||||||
  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200

  Fly   204 DDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268
            :|:.|||:|||||||.||.|:...||.||.:.::.|||||||||:.|..:..|:|::||||||||
  Fly   201 EDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYR 265

  Fly   269 CGNQAALMELDDSLKFSFLQFDPAPR--RGEPHVTRRTPDYFL 309
            |||.||::||::.|...|:.|:.||:  ||.|. .:...||||
  Fly   266 CGNVAAILELNEYLHRDFVIFEAAPQESRGIPS-KKPQADYFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 186/283 (66%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 186/283 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45619
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.