DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and ppp2cb

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001005443.1 Gene:ppp2cb / 448031 XenbaseID:XB-GENE-957248 Length:309 Species:Xenopus tropicalis


Alignment Length:309 Identity:291/309 - (94%)
Similarity:303/309 - (98%) Gaps:0/309 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDKATTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65
            ||||..||:|||||||||:|.||.|:||||||:||||||:||||||:|:||||||||||||||||
 Frog     1 MEDKTFTKELDQWIEQLNDCKQLNESQVRTLCEKAKEILTKESNVQDVRCPVTVCGDVHGQFHDL 65

  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            ||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||||
 Frog    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFY 130

  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195
            |||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||||||||
 Frog   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPM 195

  Fly   196 CDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIF 260
            ||||||||||||||||||||||||||||||||||:.|||||||||||||||||||||||||||||
 Frog   196 CDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIF 260

  Fly   261 SAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTRRTPDYFL 309
            ||||||||||||||:|||||:||:|||||||||||||||||||||||||
 Frog   261 SAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 267/283 (94%)
ppp2cbNP_001005443.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 267/283 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 403 1.000 Domainoid score I710
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 628 1.000 Inparanoid score I841
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - otm49390
Panther 1 1.100 - - LDO PTHR45619
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X621
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.