DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and flw

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster


Alignment Length:277 Identity:136/277 - (49%)
Similarity:188/277 - (67%) Gaps:2/277 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY 86
            |:||.:||.||.|::||..::..:.|::.|:.:|||:|||:.||:.||..||..|..||||:|||
  Fly   159 QMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDY 223

  Fly    87 VDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 151
            ||||..|:||:.||:|.|::|.|...:||||||...|.::|||||||.|:| |..:||.|||.|:
  Fly   224 VDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NVKLWKTFTDCFN 287

  Fly   152 YLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPD-DRGGWGISPRG 215
            .||:.|::|.:|||.||||||.:..::.||.|.|..:||..|.:||||||||| |..|||.:.||
  Fly   288 CLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRG 352

  Fly   216 AGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDD 280
            ..:|||.|:...|.|.:.|.|:.||||:|.:||.:...|.:||:|||||||....|...:|.:||
  Fly   353 VSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDD 417

  Fly   281 SLKFSFLQFDPAPRRGE 297
            :|..||....|:.::.:
  Fly   418 TLMCSFQILKPSEKKAK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 136/271 (50%)
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 135/269 (50%)
PP2Ac 160..430 CDD:197547 135/270 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.