DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and PpN58A

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:285 Identity:124/285 - (43%)
Similarity:178/285 - (62%) Gaps:8/285 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQL------NECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLME 67
            :|||.|.:|      ....|::..::..:|.:|:|:|.|:..:.|:..|:.:.||:|||:.:|:.
  Fly    23 NLDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLR 87

  Fly    68 LFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDE 132
            .|...|..||:.||.:|||||||..|:||:|||:|||.||..:..:||||||...|...||||||
  Fly    88 YFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDE 152

  Fly   133 CLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCD 197
            |.|:| ...:|:.|.|.::.|||.|:::..|||.||||||.:.|:..||.:.|..|:|..|.:||
  Fly   153 CKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICD 216

  Fly   198 LLWSDPDDR-GGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFS 261
            :||||||.| .|||.:.||..:|||.|:...|.:...|.|:.|.||:|.:||.:...|.::||||
  Fly   217 ILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFS 281

  Fly   262 APNYCYRCGNQAALMELDDSLKFSF 286
            |||||....|..|:|.::..|..:|
  Fly   282 APNYCGEFDNAGAMMCINQDLLCTF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 124/285 (44%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 124/285 (44%)
MPP_superfamily 23..311 CDD:301300 124/285 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.