DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:293 Identity:115/293 - (39%)
Similarity:174/293 - (59%) Gaps:20/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CNQL-TETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGG------KSPD 77
            |..| .|.::..:|.:|:|...||....|::.|||:|||:||||.||:.:|.|.|      |...
 Worm    32 CQTLFQEKEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHVSQKDKS 96

  Fly    78 TNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANV 142
            :.|||:|||:|||.:|:|.:|||.|.::.:.:::.:||||||||.:...||||:||.|:| :..:
 Worm    97 SRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRRY-SVTL 160

  Fly   143 WKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP-DDR 206
            ::.|...|..:||.|:|.|:|.|:|||:...:.||:.|....|..::...|...||.|:|| ...
 Worm   161 YETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDIADVGIPSDLCWADPVSGV 225

  Fly   207 GGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGN 271
            .|:..||||||:.||:...:.||....|.|:.||||:||:||.:..|:.:|||||||.||....|
 Worm   226 VGFQDSPRGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKKLVTIFSAPCYCGHFDN 290

  Fly   272 QAALMELDDSLKFSFLQFD-----------PAP 293
            ..|::::..:::.:...|.           |||
 Worm   291 LGAVLQVATNMECTINTFGHDLSAAPIKKAPAP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 113/291 (39%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 109/272 (40%)
MPP_superfamily 36..304 CDD:301300 109/268 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.