DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and ppp1cbl

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_956210.1 Gene:ppp1cbl / 334597 ZFINID:ZDB-GENE-030131-6529 Length:281 Species:Danio rerio


Alignment Length:315 Identity:122/315 - (38%)
Similarity:168/315 - (53%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNE---CN-----QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65
            |:|..|.:|.|   |.     |:||.:||.||.|::||...:        |:            |
Zfish     7 DVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQ--------PI------------L 51

  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            :||                          ||:.||:|.|::|.|...:||||||...|.::||||
Zfish    52 LEL--------------------------ETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 90

  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195
            |||.|:: |..:||.|||.|:.||:.|:||.:|||.||||||.:.|::.||.:.|..:||..|.:
Zfish    91 DECKRRF-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 154

  Fly   196 CDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTI 259
            ||||||||| |..|||.:.||..:|||.|:...|.|.:.|.|:.||||:|.:||.:...|.:||:
Zfish   155 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 219

  Fly   260 FSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRR----------GEPHVTRRT 304
            |||||||....|...:|.:|::|..||....|:.::          |.|....||
Zfish   220 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPPRT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 118/292 (40%)
ppp1cblNP_956210.1 PTZ00480 3..254 CDD:185658 118/293 (40%)
MPP_superfamily 7..251 CDD:301300 117/290 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.