DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Ppp3ca

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_058737.1 Gene:Ppp3ca / 24674 RGDID:3382 Length:521 Species:Rattus norvegicus


Alignment Length:286 Identity:121/286 - (42%)
Similarity:171/286 - (59%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY 86
            :|.|:....:..:...||.:|.|:.::..|||||||:||||.|||:||.:||...:|.|||:|||
  Rat    55 RLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDY 119

  Fly    87 VDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 151
            |||||:|:|.|..|.|||:.|.:.:.:||||||.|.:|:.:.|..||..|| :..|:....|.||
  Rat   120 VDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFD 183

  Fly   152 YLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP-DDRGGWGI---- 211
            .|||.||::.|..|:||||||.|::||.||.|||.:|.|..|||||:||||| :|.|....    
  Rat   184 CLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHF 248

  Fly   212 ---SPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDR------NVVTIFSAPNYCY 267
               :.||..|.:.......|...|.|..:.|||:....||......      :::||||||||..
  Rat   249 THNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD 313

  Fly   268 RCGNQAALMELDDSLKFSFLQFDPAP 293
            ...|:||:::.:::: .:..||:.:|
  Rat   314 VYNNKAAVLKYENNV-MNIRQFNCSP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 120/284 (42%)
Ppp3caNP_058737.1 MPP_PP2B 41..345 CDD:277361 121/286 (42%)
Catalytic. /evidence=ECO:0000305 56..340 121/285 (42%)
SAPNY motif. /evidence=ECO:0000250|UniProtKB:Q08209 307..311 3/3 (100%)
Interaction with PxIxIF motif in substrate. /evidence=ECO:0000250|UniProtKB:Q08209 327..336 2/9 (22%)
Calcineurin B binding. /evidence=ECO:0000250|UniProtKB:Q08209 341..369
Calmodulin-binding. /evidence=ECO:0000250|UniProtKB:Q08209 392..406
Autoinhibitory segment. /evidence=ECO:0000250|UniProtKB:P16298 407..414
Autoinhibitory domain. /evidence=ECO:0000269|PubMed:1322410 465..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.