DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:303 Identity:142/303 - (46%)
Similarity:204/303 - (67%) Gaps:11/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECN--------QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65
            ::|..|::|.|..        ||.|.::|.||.|::||...:..:.|::.|:.:|||:|||::||
  Rat     8 NIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDL 72

  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            :.||..||..|::||||:|||||||..|:||:.||:|.|::|.|...:||||||...|.::||||
  Rat    73 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 137

  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195
            |||.|:| |..:||.|||.|:.||:.|:||.:|||.||||||.:.|::.||.:.|..:||.:|.:
  Rat   138 DECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   196 CDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTI 259
            ||||||||| |..|||.:.||..:|||.::...|.:.:.|.|:.||||:|.:||.:...|.:||:
  Rat   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   260 FSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTR 302
            |||||||....|..|:|.:|::|..||....||.:: :|:.||
  Rat   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK-KPNATR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 138/292 (47%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 137/290 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.