DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006530263.1 Gene:Ppp1cc / 19047 MGIID:104872 Length:337 Species:Mus musculus


Alignment Length:303 Identity:142/303 - (46%)
Similarity:204/303 - (67%) Gaps:11/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLDQWIEQLNECN--------QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65
            ::|..|::|.|..        ||.|.::|.||.|::||...:..:.|::.|:.:|||:|||::||
Mouse     8 NIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDL 72

  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130
            :.||..||..|::||||:|||||||..|:||:.||:|.|::|.|...:||||||...|.::||||
Mouse    73 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 137

  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195
            |||.|:| |..:||.|||.|:.||:.|:||.:|||.||||||.:.|::.||.:.|..:||.:|.:
Mouse   138 DECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   196 CDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTI 259
            ||||||||| |..|||.:.||..:|||.::...|.:.:.|.|:.||||:|.:||.:...|.:||:
Mouse   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   260 FSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRRGEPHVTR 302
            |||||||....|..|:|.:|::|..||....||.:: :|:.||
Mouse   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKK-KPNATR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 138/292 (47%)
Ppp1ccXP_006530263.1 MPP_PP1_PPKL 8..298 CDD:277359 137/290 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.