DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Ppef2

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_030110066.1 Gene:Ppef2 / 19023 MGIID:1342304 Length:797 Species:Mus musculus


Alignment Length:424 Identity:112/424 - (26%)
Similarity:162/424 - (38%) Gaps:142/424 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDKATTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVK-C---PVTVCGDVHGQ 61
            :.|.||.     .:|......||....|..|..:.::.|::..|:..|. |   .||||||:|||
Mouse   164 LPDHATA-----LVEAFRLRQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQ 223

  Fly    62 FHDLMELF-RIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQ 125
            ..||:.:| :.|..||:..|:|.||:||||..|||.:.:|.|..:.|.:...:.|||||...:..
Mouse   224 LDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNL 288

  Fly   126 VYGFYDECLRKY--GNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDR--- 185
            .|||..|.:.||  ....:.:...|:|.:|||..|||.::..||||:|...| |:.:..|||   
Mouse   289 RYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTD-LELLAKLDRHKI 352

  Fly   186 ----------------------------------------------------------------- 185
                                                                             
Mouse   353 VSTMRCKTRKESENREEQKRKDNQTSSGQKPTPWFLPQSRSLPSSPFHLGSGFKAYKAGRSCSIP 417

  Fly   186 ---------------------------------------------------------LQEVPHE- 192
                                                                     |:..|.| 
Mouse   418 CGSPNSKELSRRGQVRRSVDLELEQCRQQAGFLGIREKGESLPLAPDADCVADGGGVLEPTPEEW 482

  Fly   193 GPMCDLLWSDPDDRGGWGISP-RGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNV 256
            ..:.|:|||||..:.|...:. ||.|..||.|::|.......|.|:.|:|:...|||.:||:|.|
Mouse   483 KQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKV 547

  Fly   257 VTIFSAPNYCYRCG-NQAALMELDDSLKFSFLQF 289
            :|||||.|| |..| |:.|.::|..:|....:|:
Mouse   548 LTIFSASNY-YEVGSNRGAYVKLGPALTPHIVQY 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 109/416 (26%)
Ppef2XP_030110066.1 IQ 61..80 CDD:197470
MPP_RdgC 162..581 CDD:277364 112/424 (26%)
FRQ1 621..765 CDD:227455
EFh 701..766 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.