DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Y40H4A.2

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_506609.2 Gene:Y40H4A.2 / 189799 WormBaseID:WBGene00012741 Length:333 Species:Caenorhabditis elegans


Alignment Length:283 Identity:106/283 - (37%)
Similarity:155/283 - (54%) Gaps:12/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTETQVRTLCDKAKEILSKESNVQEV--KC-PVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMG 84
            :::.::|.:.:.|.......|.:..|  .| ||.:.||:||.|.||..:|.|.|....::|:|:|
 Worm    48 VSKEEIRIISNYAAASFGSFSTLMRVDEDCLPVHIVGDLHGHFGDLRRIFGIHGAPGISHYVFLG 112

  Fly    85 DYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNAN--VWKYFT 147
            ||||||...:|||.||:|....|.:.:.:.|||||....|..|||:|||..|||...  .|.:..
 Worm   113 DYVDRGRQGIETVMLLMAYHCLYPDHLFLCRGNHEDYNTTMTYGFFDECRMKYGKKGTLAWLHII 177

  Fly   148 DLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDDRG--GWG 210
            :.|::|||.||:..::.|:|||:||.|..|:.|..:.|...:|..|..|||:||||:...  ||.
 Worm   178 NAFNHLPLAALILDKVLCMHGGISPHIQKLEDIDKIQRPTFIPSYGLACDLVWSDPEKTSNVGWS 242

  Fly   211 ISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVME----GYNWCHDRNVVTIFSAPNYCYRCGN 271
            :|.||..::|.....|.|...|||.|:.||||:..|    |:.|..:..:||||||.|| ...||
 Worm   243 LSARGISFSFDDITIEKFCQDNGLDLIVRAHQISSEMIRGGHKWHANGRMVTIFSAANY-LSMGN 306

  Fly   272 QAALMELDDSLKFSFLQFDPAPR 294
            .:.::.:|:.....|....|..:
 Worm   307 DSCVIRIDEQKTMQFCLLRPVKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 106/280 (38%)
Y40H4A.2NP_506609.2 PP2Ac 49..328 CDD:197547 106/279 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.