DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and F44B9.9

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:274 Identity:75/274 - (27%)
Similarity:117/274 - (42%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDT---------- 78
            ::|::..|.|...|:..||..:.|:..|||:.||:||||.||:.|......|.:.          
 Worm     5 SKTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFST 69

  Fly    79 -NYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANV 142
             .::|:||||||||.|::.:.|:.:||:.:.::..:||||||:|.|...||| ..|         
 Worm    70 KKWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF-RVC--------- 124

  Fly   143 WKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDPDDRG 207
                               .:..|.....||.     ||.                         
 Worm   125 -------------------SVVVLKIPAKPSF-----IRN------------------------- 140

  Fly   208 GWGISPRGAGYTFGQ-DISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGN 271
                :.||....|.: .::||....| ::|:.|.||::..|:.:..||.:.||||||.|.....|
 Worm   141 ----NKRGLSVCFNEAAVNETCRLLN-ISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDN 200

  Fly   272 QAALMELDDSLKFS 285
            ..|:|::..:.|.|
 Worm   201 SGAVMKVASNGKIS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 75/274 (27%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 75/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.