DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and F25B3.4

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001369922.1 Gene:F25B3.4 / 184915 WormBaseID:WBGene00009101 Length:363 Species:Caenorhabditis elegans


Alignment Length:279 Identity:120/279 - (43%)
Similarity:166/279 - (59%) Gaps:6/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYY 92
            |.||...|..|.:|:..:.||..|:.:|||:||||.||:.||...|.....||||:|||||||.:
 Worm    84 VETLLFHAFSIFNKQPMLIEVNSPINICGDIHGQFSDLLRLFDKNGFPHRANYLFLGDYVDRGKH 148

  Fly    93 SVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTA 157
            .:||:.||.|.||.:.....:||||||...|.:.||||:||.|:|...:||..|..:|..:||||
 Worm   149 CLETILLLFAYKVIFPNHFFMLRGNHECSLINRQYGFYEECQRRYNKPSVWHSFQGVFSVMPLTA 213

  Fly   158 LVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMC-DLLWSDPDD-RGGWGISPRGAGYTF 220
            ||..:|.|:|||:|..:.::..:||:.|..:.|....:. |:|||||.: :.||..:.||..|.|
 Worm   214 LVGQRILCMHGGVSKMLQNVSQLRAIKRPFDNPEPNTLAIDILWSDPTNFQKGWNPNSRGVSYVF 278

  Fly   221 GQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDDSLKFS 285
            |.|......:...:.||.||||:|.:||.:..:|.:|||||||.||.:..|.||:|.::.:|..|
 Worm   279 GSDALRKLLDRLQIDLVVRAHQVVQDGYEFFANRRLVTIFSAPFYCGQFDNAAAVMYVNKNLVCS 343

  Fly   286 FLQFDP----APRRGEPHV 300
            |:...|    |.||..|.|
 Worm   344 FVVLRPRKKIARRRMMPAV 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 115/270 (43%)
F25B3.4NP_001369922.1 PP2Ac 79..351 CDD:197547 115/266 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.