DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and C24H11.1

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_499527.1 Gene:C24H11.1 / 182859 WormBaseID:WBGene00007699 Length:384 Species:Caenorhabditis elegans


Alignment Length:262 Identity:101/262 - (38%)
Similarity:155/262 - (59%) Gaps:12/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI 111
            |::.|:.:|||.|||::||:.:|...|.:..|.|||:|||||||.:|:|.:.||.:||:....::
 Worm   109 ELQAPINICGDTHGQYNDLLRIFNACGAATKTQYLFLGDYVDRGGHSLEVIMLLFSLKLAMPRKM 173

  Fly   112 TILRGNHESRQITQVYGFYDECLRKYGN----ANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSP 172
            .:||||||.:.|.:.|||:.|..:::..    .:|:.:|..:|.|:||.|:|..:|.|:|||:||
 Worm   174 HLLRGNHELKAINKNYGFHAELKKRFQREEVYESVYNHFNQVFSYMPLCAIVSKRILCMHGGISP 238

  Fly   173 SIDSLDHIRALDRLQEVPHEGPM-CDLLWSDPDDRGGWGISP---RGAGYTFGQDISETFNNTNG 233
            .:.|||.|||:....|.....|: |||||:|| ::...|..|   |.....||:...:.......
 Worm   239 HLKSLDDIRAIPLPLETAKTHPLACDLLWADP-EKDAKGFEPNKIRAISNVFGKKEVDDLCKRLD 302

  Fly   234 LTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAP---RR 295
            :.|:.||||:|..||.:..||.::|:|||..|.....|.||::.::..|:.||:|..|..   ||
 Worm   303 IDLIVRAHQVVEYGYAFFADRRLITVFSASRYQIELCNYAAVVVVNKMLELSFVQLKPEDFEVRR 367

  Fly   296 GE 297
            .|
 Worm   368 DE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 98/253 (39%)
C24H11.1NP_499527.1 MPP_superfamily 43..360 CDD:301300 97/251 (39%)
PP2Ac 106..360 CDD:197547 97/251 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.