DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and F58G1.3

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_496754.2 Gene:F58G1.3 / 174933 WormBaseID:WBGene00010265 Length:364 Species:Caenorhabditis elegans


Alignment Length:298 Identity:117/298 - (39%)
Similarity:176/298 - (59%) Gaps:15/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LDQWIE-------------QLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQ 61
            |.:|::             .:|.||.:|..::..:....:.|...|||:.|.:.|:.|.||:|.|
 Worm    33 LAEWMDDCIKRMNSLYKDTNINICNVMTGHEIIAIIRMVEAIFMDESNLCEAEAPIKVIGDIHAQ 97

  Fly    62 FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQV 126
            |.|:..||.:.|:.|:...:|:|||||||...:|.:.||..||:|||:||.:||||||:..:.::
 Worm    98 FQDMNRLFDLIGRVPEEKLMFLGDYVDRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKI 162

  Fly   127 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPH 191
            ||||.||..||| ..:|..|...|:.:|::.|:..::.|:||||||.:.:||.||.:.|..|...
 Worm   163 YGFYVECQYKYG-VGLWWDFQTCFNRMPMSGLISKRVLCMHGGLSPELINLDTIRNIPRPCEPLD 226

  Fly   192 EGPMCDLLWSDPDDRG-GWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRN 255
            .|.:.|||||||.::| ||..|.||..|.||:.:.|....:..:.|:.|.||:|.:||.....|.
 Worm   227 RGLLIDLLWSDPTNKGEGWFHSIRGISYMFGKGVVEQACKSLEIDLIIRGHQVVQDGYEMMAGRR 291

  Fly   256 VVTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAP 293
            ::|:||.||||.:..|.||::.|:.:|:.||.|..|.|
 Worm   292 LITVFSVPNYCAQFTNAAAVVCLNANLQVSFQQLIPPP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 116/296 (39%)
F58G1.3NP_496754.2 MPP_superfamily 37..327 CDD:301300 113/290 (39%)
PP2Ac 59..329 CDD:197547 111/270 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.