DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and Ppp4c

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_599186.1 Gene:Ppp4c / 171366 RGDID:621225 Length:307 Species:Rattus norvegicus


Alignment Length:307 Identity:199/307 - (64%)
Similarity:245/307 - (79%) Gaps:3/307 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATTKDLDQWIEQLNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELF 69
            |...|||:.||||..|..:.|::|:.||.||:|||.:|||||.|..|||||||:||||:||.|||
  Rat     2 AEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELF 66

  Fly    70 RIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECL 134
            |:||..|:||||||||:||||:|||||..||:||||||.:|||::||||||||||||||||||||
  Rat    67 RVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECL 131

  Fly   135 RKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLL 199
            ||||:..||:|.|::||||.|:|::||:|||:||||||||.:||.||.:||.|||||:|||||||
  Rat   132 RKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLL 196

  Fly   200 WSDPDDRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPN 264
            ||||:|..|||:|||||||.||.|:...||..|.:.:..||||||||||.|..:..|:|::||||
  Rat   197 WSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMTCRAHQLVMEGYKWHFNETVLTVWSAPN 261

  Fly   265 YCYRCGNQAALMELDDSLKFSFLQFDPAPR--RGEPHVTRRTPDYFL 309
            |||||||.||::|||:.|:..|:.|:.||:  ||.|. .:...||||
  Rat   262 YCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPS-KKPVADYFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 189/283 (67%)
Ppp4cNP_599186.1 PTZ00239 6..307 CDD:173488 196/301 (65%)
MPP_PP2A_PP4_PP6 6..290 CDD:277360 189/283 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.