DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mts and ppp3cb

DIOPT Version :9

Sequence 1:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_012813808.1 Gene:ppp3cb / 100037840 XenbaseID:XB-GENE-949827 Length:531 Species:Xenopus tropicalis


Alignment Length:286 Identity:121/286 - (42%)
Similarity:169/286 - (59%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY 86
            :|.|.....:..:...||.:|..:.||:.|:|||||:||||.|||:||.:||...:|.|||:|||
 Frog    77 RLEEEAALRIIREGAAILRQEKTMLEVEAPITVCGDIHGQFFDLMKLFEVGGTPHNTRYLFLGDY 141

  Fly    87 VDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 151
            |||||:|:|.|..|.:||:.:.:.:.:||||||.|.:|:.:.|..||..|| :..|:....|.||
 Frog   142 VDRGYFSIECVLYLWSLKIIHPKTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDSCMDAFD 205

  Fly   152 YLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPMCDLLWSDP-DDRGGWGI---- 211
            .|||.||::.|..|:||||||.|..||.||.|||.:|.|..||||||||||| :|.|....    
 Frog   206 CLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPAEDYGSEKTLEHF 270

  Fly   212 ---SPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDR------NVVTIFSAPNYCY 267
               :.||..|.:.......|..:|.|..|.|||:....||......      :::||||||||..
 Frog   271 THNTVRGCSYFYSYPAVCEFLQSNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD 335

  Fly   268 RCGNQAALMELDDSLKFSFLQFDPAP 293
            ...|:||:::.:::: .:..||:.:|
 Frog   336 VYNNKAAVLKYENNV-MNIRQFNCSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 120/284 (42%)
ppp3cbXP_012813808.1 MPP_PP2B 63..367 CDD:277361 121/286 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.