DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MUSK and Tie

DIOPT Version :10

Sequence 1:XP_005252051.1 Gene:MUSK / 4593 HGNCID:7525 Length:879 Species:Homo sapiens
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:94 Identity:17/94 - (18%)
Similarity:26/94 - (27%) Gaps:34/94 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   106 PSSRWALWSVGGEVHVALQI----------------------------PFNVSSLVAMYSTALLS 142
            |.:.:|.|...|..|..:::                            .|..|.|:.......|.
  Fly    26 PINGYAYWLGLGVYHSGVEVHGIEYAYGAHEYPSTGIFEGEPKQCEGFTFRKSILIGKTDLGPLE 90

Human   143 LDHYIERALPRTYMASVY-----NTRHVC 166
            :...:|: |...|..|.|     |..|.|
  Fly    91 VRATMEQ-LADNYKGSSYNLITKNCNHFC 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MUSKXP_005252051.1 IgI_1_MuSK 28..117 CDD:409562 3/10 (30%)
Ig strand A 28..31 CDD:409562
Ig strand A' 35..39 CDD:409562
Ig strand B 45..52 CDD:409562
Ig strand C 58..63 CDD:409562
Ig strand C' 65..67 CDD:409562
Ig strand D 75..78 CDD:409562
Ig strand E 82..88 CDD:409562
Ig strand F 95..102 CDD:409562
Ig strand G 109..117 CDD:409562 2/7 (29%)
Ig 122..206 CDD:472250 12/78 (15%)
Ig strand B 138..142 CDD:409353 0/3 (0%)
Ig strand C 151..155 CDD:409353 1/3 (33%)
Ig strand E 173..177 CDD:409353
Ig strand F 187..192 CDD:409353
Ig strand G 201..204 CDD:409353
Ig_3 228..296 CDD:464046
CRD_FZ 325..467 CDD:470581
PTKc_Musk 579..868 CDD:133181
TieNP_523928.1 TyrKc 854..1183 CDD:197581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.