DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MUSK and lin-18

DIOPT Version :9

Sequence 1:XP_005252051.1 Gene:MUSK / 4593 HGNCID:7525 Length:879 Species:Homo sapiens
Sequence 2:NP_508684.4 Gene:lin-18 / 180679 WormBaseID:WBGene00003007 Length:583 Species:Caenorhabditis elegans


Alignment Length:411 Identity:118/411 - (28%)
Similarity:182/411 - (44%) Gaps:81/411 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   506 VIISIMSSFAIFVLLTITTLYCCRRRKQWKNKK------------RESAAVTLTTLPSELLLDRL 558
            |||.|.   |.|:|:...||.|..:|    :||            |.|...|.:..|..|...|.
 Worm   177 VIICIA---AAFLLIVAATLICYFKR----SKKEDMIPTRLPTSFRNSLKSTKSAQPFLLSTPRD 234

Human   559 HP------------------NPMYQRMPLLLNPK--LLSLEYPRNNIEYVRDIGEGAFGRVFQA- 602
            .|                  |.:....|..::.:  ||.|...|:..:.:....||.||.|..| 
 Worm   235 GPPTLSAISSAPCSSSSASGNSIIPSKPRNIDVRRALLQLYQDRDAFQSLPLDMEGTFGEVRYAI 299

Human   603 ------RAPGLLPYEPFTM-----VAVKMLKEEASADMQADFQREAALMAEF-DNPNIVKLLGVC 655
                  ...|.:..|..|.     |..|.||..||......|..:|.|.... .:.|:.::..|.
 Worm   300 WRQVDDVLNGDVDDEEDTFCNQEAVYTKTLKNNASPIQLDRFLSDALLFYNITPHQNLSQVACVA 364

Human   656 AVGK----------PMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCA 710
            :.|:          |: :.:.:..:|:|.:||      |:|  .|.|.:..||.       |...
 Worm   365 SFGRFDRPETVTDFPL-VCYRHQGFGNLKKFL------TIC--RHGDKTKGAQT-------LRTH 413

Human   711 EQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGE---NMVVKIADFGLSRNIYSADYYKANEND 772
            :.:.:|.||::.:|::.:.:.||.|:|.||||:.|   .:.|::.|..|||:::.|||:...:|:
 Worm   414 QLVSLATQVSSAVAHIHKYRIVHNDIAARNCLIAEVNGRLQVQLCDSALSRDLFPADYHCLGDNE 478

Human   773 AIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENC 837
            ..|::||.||:|....|::.:|||:.||:|||:.|.|..|:..:..|||...:..|..|..|.||
 Worm   479 NRPLKWMSPEAIANELYSSAADVWSLGVLLWELMSLGGSPHAEIDPEEVYTMILKGKRLQQPNNC 543

Human   838 PVELYNLMRLCWSKLPADRPS 858
            |.:||.:|..||..|..||||
 Worm   544 PDQLYEVMLCCWRVLSEDRPS 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MUSKXP_005252051.1 I-set 28..117 CDD:254352
Ig 36..117 CDD:299845
I-set 121..203 CDD:254352
Ig 135..201 CDD:299845
I-set 223..306 CDD:254352
Ig 239..306 CDD:143165
CRD_FZ 325..467 CDD:295308
PTKc_Musk 579..868 CDD:133181 93/306 (30%)
Pkinase_Tyr 585..866 CDD:285015 92/300 (31%)
lin-18NP_508684.4 WIF 19..149 CDD:128745
PTK_Ryk 274..579 CDD:270639 94/307 (31%)
Pkinase_Tyr 289..572 CDD:285015 92/292 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.