DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shi and DRP4A

DIOPT Version :9

Sequence 1:NP_001259588.1 Gene:shi / 45928 FlyBaseID:FBgn0003392 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_176253.1 Gene:DRP4A / 842348 AraportID:AT1G60530 Length:301 Species:Arabidopsis thaliana


Alignment Length:258 Identity:91/258 - (35%)
Similarity:148/258 - (57%) Gaps:15/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LITIVNKLQDAFTSLGVHMQ-LDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQ 67
            |:..|::|:    :|.|..: :.||.|.|||.||:|||||||:..|.: ||||.||.||.||:::
plant    43 LLDTVDRLR----NLNVMREGIQLPTIVVVGDQSSGKSSVLESLAGIN-LPRGQGICTRVPLVMR 102

  Fly    68 LINGVTEYGE-FLHIKGKKFSSFDE-IRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLI 130
            |....:...| :|....|...:.:| :.:.|...||.:.|:.:|:|:.|:.|.|...:|.:||::
plant   103 LQRSSSPEPEIWLEYSDKVVPTDEEHVAEAICAATDVIAGTGEGVSDTPLTLSVKKNNVPDLTMV 167

  Fly   131 DLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRT 195
            ||||:|:|.:..||.:|.:||.:||.::|..:..:||.|..|..|....::::::::||..|.||
plant   168 DLPGITRVPVNGQPENIYEQISRMIMKYIEPQESIILNVLSATVDFTTCESIRMSRQVDKTGERT 232

  Fly   196 IGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHP 258
            :.|:||.|:..||...:...::..:.|  |||.|.||.     |.:...:|...|...|.:||
plant   233 LAVVTKADMAPEGLLQKVTADDVSIGL--GYICVRNRI-----GEETYEEARVQEDLLFRTHP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shiNP_001259588.1 DYNc 1..240 CDD:197491 85/238 (36%)
CrfC 73..>498 CDD:223771 59/188 (31%)
Dynamin_M 212..498 CDD:279383 13/47 (28%)
PH_dynamin 512..644 CDD:269958
PH 552..638 CDD:278594
GED 664..755 CDD:128597
DUF4527 <758..819 CDD:291689
Drf_FH1 <761..>846 CDD:283903
DRP4ANP_176253.1 DLP_1 60..300 CDD:206738 86/237 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.