DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shi and DRP5A

DIOPT Version :9

Sequence 1:NP_001259588.1 Gene:shi / 45928 FlyBaseID:FBgn0003392 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_175722.1 Gene:DRP5A / 841748 AraportID:AT1G53140 Length:817 Species:Arabidopsis thaliana


Alignment Length:605 Identity:136/605 - (22%)
Similarity:228/605 - (37%) Gaps:153/605 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVT 73
            |:||.|..:.|  .:|.:|:|..:||||.||||:||..:|..|..|...:.||||||||:::.::
plant    47 NRLQAAAVAFG--EKLPIPEIVAIGGQSDGKSSLLEALLGFRFNVREVEMGTRRPLILQMVHDLS 109

  Fly    74 --------------EYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNK-GISNIPINLRVYSPH 123
                          ||       |....|...:...|...|:.:....| .:|..||.:|....|
plant   110 ALEPRCRFQDEDSEEY-------GSPIVSATAVADVIRSRTEALLKKTKTAVSPKPIVMRAEYAH 167

  Fly   124 VLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEV 188
            ..|||:||.||....|...:|.....:|..|:.........::|.:..::.:..:|..|...:|:
plant   168 CPNLTIIDTPGFVLKAKKGEPETTPDEILSMVKSLASPPHRILLFLQQSSVEWCSSLWLDAVREI 232

  Fly   189 DPQGVRTIGVITKLD-LMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERK 252
            |....|||.|::|.| .:.|.:|..::  ::.|. ..||:|         |..:....||..:|.
plant   233 DSSFRRTIVVVSKFDNRLKEFSDRGEV--DRYLS-ASGYLG---------ENTRPYFVALPKDRS 285

  Fly   253 FFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPG---------------LRDKLQKQMLTL 302
             .:|:..:|....::.|         ::..|:|:.:.|               |||.|:.:   |
plant   286 -TISNDEFRRQISQVDT---------EVIRHLREGVKGGFDEEKFRSCIGFGSLRDFLESE---L 337

  Fly   303 EKEVEEFKHFQPGDASI-------KTKAMLQMIQQLQ--SD----------FERTIEGSGSALVN 348
            :|   .:|...|...::       .|..||:|..::|  ||          :..:|.....||::
plant   338 QK---RYKEAAPATLALLEERCSEVTDDMLRMDMKIQATSDVAHLRKAAMLYTASISNHVGALID 399

  Fly   349 -------------TNE-------------------------LSGGAKINRIFHERLRFEIVKMAC 375
                         |.|                         |.|||...|:.||   |.....:.
plant   400 GAANPAPEQWGKTTEEERGESGIGSWPGVSVDIKPPNAVLKLYGGAAFERVIHE---FRCAAYSI 461

  Fly   376 DEKELRREISFAIRNIHGIRVG-----LFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQEL-SVV 434
            :...:.||....|...|..|.|     ..:.::|..| .:..:|.|.:.....:..|:..| .:.
plant   462 ECPPVSREKVANILLAHAGRGGGRGVTEASAEIARTA-ARSWLAPLLDTACDRLAFVLGSLFEIA 525

  Fly   435 VRMCTAKMSRYPRLREETERIITTH----------VRQREHSCKEQILLLID-----FELA-YMN 483
            :.....:.|.|.:..|..:..:..|          |:.....||:.:...:|     :.:| |.|
plant   526 LERNLNQNSEYEKKTENMDGYVGFHAAVRNCYSRFVKNLAKQCKQLVRHHLDSVTSPYSMACYEN 590

  Fly   484 TNHEDFIGFANAQNKSENAN 503
            ..|:.  |...|.||...|:
plant   591 NYHQG--GAFGAYNKFNQAS 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shiNP_001259588.1 DYNc 1..240 CDD:197491 70/246 (28%)
CrfC 73..>498 CDD:223771 104/534 (19%)
Dynamin_M 212..498 CDD:279383 68/379 (18%)
PH_dynamin 512..644 CDD:269958
PH 552..638 CDD:278594
GED 664..755 CDD:128597
DUF4527 <758..819 CDD:291689
Drf_FH1 <761..>846 CDD:283903
DRP5ANP_175722.1 DLP_1 60..346 CDD:206738 81/320 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.