DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shi and ARC5

DIOPT Version :9

Sequence 1:NP_001259588.1 Gene:shi / 45928 FlyBaseID:FBgn0003392 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001189935.1 Gene:ARC5 / 821509 AraportID:AT3G19720 Length:777 Species:Arabidopsis thaliana


Alignment Length:620 Identity:125/620 - (20%)
Similarity:236/620 - (38%) Gaps:145/620 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LQDAFTSLGVHMQ-----LDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIN 70
            |.:|:..|....|     .:.|.:.|||.|:.|||:::|..:|..|...|.|..||||:.|.:..
plant    28 LYEAYNELHALAQELETPFEAPAVLVVGQQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKY 92

  Fly    71 GVTEYGEFLHIKGKKF------SSFDEIRKEIEDETDRVTGSN-KGISNIPINLRVYSPHVLNLT 128
            .........|:.....      .|..:|:..||.|..|:.... ...|...|.::|...:..|||
plant    93 DPQCQFPLCHLGSDDDPSVSLPKSLSQIQAYIEAENMRLEQEPCSPFSAKEIIVKVQYKYCPNLT 157

  Fly   129 LIDLPGLTKVAIG--DQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQ 191
            :||.|||...|.|  ::.:.::.:..:.:.:...:....|:.....::|.:.:...::..:|||:
plant   158 IIDTPGLIAPAPGLKNRALQVQARAVEALVRAKMQHKEFIILCLEDSSDWSIATTRRIVMQVDPE 222

  Fly   192 GVRTIGVITKLDL-MDEGTDARDI----------LENKLL---PL-------RRGY----IGVVN 231
            ..|||.|.||||. :.:.:.:.|:          |::.||   |.       |.||    :...|
plant   223 LSRTIVVSTKLDTKIPQFSCSSDVEVFLSPPASALDSSLLGDSPFFTSVPSGRVGYGQDSVYKSN 287

  Fly   232 RSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQ 296
            ...|.....:::....:.|:|  |.....:....|:|...|:..|.:.|....::::|.:...|.
plant   288 DEFKQAVSLREMEDIASLEKK--LGRLLTKQEKSRIGISKLRLFLEELLWKRYKESVPLIIPLLG 350

  Fly   297 KQ-------MLTLEKEVEEFKHFQPGDASIKTKAML---QMIQQLQSDFERTIE------GSGSA 345
            |:       :.|:.||:.....|...:|.:|.:...   ..:.:|....:.|:.      |:.:|
plant   351 KEYRSTVRKLDTVSKELRSQFVFSLDEAKLKERGRTFHDLFLTKLSLLLKGTVVAPPDKFGNVTA 415

  Fly   346 LVNTNELSGGAKINRIFHERLRF-EIVKM-ACDEKELRRE-------------ISFAIRNIHGIR 395
            |.:.::|        ::|:...| .:||: .|...|..::             :.|:.:.|....
plant   416 LFSASQL--------LWHKLFLFLGVVKLDFCKISETLQDERTQGGAFVGTDGLQFSHKLIPNAG 472

  Fly   396 VGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQEL------------------SVVVRMCTAKM 442
            :.|:.......|:.:.:..:   ..|||..:..:|:                  :.|:.:..|:.
plant   473 MRLYGGAQYHRAMAEFRFLV---GAIKCPPITREEIVNACGVEDIHDGTNYSRTACVIAVAKARE 534

  Fly   443 SRYPRLREETERIITTHVRQREHSCKEQILL-----LIDFELAYMNTNHEDFI--------GFAN 494
            :..|.|.:...|::  |:.:|        ||     |:..|..|: :.||.|:        .|..
plant   535 TFEPFLHQLGARLL--HILKR--------LLPISVYLLQKEGEYL-SGHEVFLKRVASAFNSFVE 588

  Fly   495 AQNKS--------------------ENANKTGTRQ 509
            :..||                    .|.|:.|.||
plant   589 STEKSCRDKCMEDLASTTRYVTWSLHNKNRAGLRQ 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shiNP_001259588.1 DYNc 1..240 CDD:197491 65/267 (24%)
CrfC 73..>498 CDD:223771 96/520 (18%)
Dynamin_M 212..498 CDD:279383 63/371 (17%)
PH_dynamin 512..644 CDD:269958
PH 552..638 CDD:278594
GED 664..755 CDD:128597
DUF4527 <758..819 CDD:291689
Drf_FH1 <761..>846 CDD:283903
ARC5NP_001189935.1 DLP_1 49..343 CDD:206738 69/295 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.