DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and CDC20

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001246.2 Gene:CDC20 / 991 HGNCID:1723 Length:499 Species:Homo sapiens


Alignment Length:476 Identity:182/476 - (38%)
Similarity:255/476 - (53%) Gaps:93/476 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TTPTSL--DRFIPCRAYNNWQTNFASINKSNDNSPQTSKKQRDCGETARDSLAYSCLLKNELLGS 91
            |||:..  ||:||.|:..  |...||...|.:|.|:.|                           
Human    69 TTPSKPGGDRYIPHRSAA--QMEVASFLLSKENQPENS--------------------------- 104

  Fly    92 AIDDVKTAGEERNENAYTPAAKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQKLLR--------- 147
                                        |:|||:::......:|:....:..|:||         
Human   105 ----------------------------QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAP 141

  Fly   148 ------------------SPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCV 194
                              |.||..|.|..:|.::|||||:::|:|||||||||.|||||.|.:.|
Human   142 EGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSV 206

  Fly   195 YLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINKLNGHSARV 259
            |||||.:..:.:|..:......::||:|.:.||.:||||....|.:|||...|::..:..|||||
Human   207 YLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARV 271

  Fly   260 GALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYV 324
            |:|:|||.|||||||...|...|.|..: .....|:||.||||||:|:||.::||||||||.:.|
Human   272 GSLSWNSYILSSGSRSGHIHHHDVRVAE-HHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNV 335

  Fly   325 W----NQHSVNPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGS 385
            |    .:....|:|::|:|..||||:||.|....:||:||||:||.||.||..:|..:..||..|
Human   336 WPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS 400

  Fly   386 QVCNLAWSKHSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDE 450
            |||::.||.|..||:|.||::|||:::||||::.:||:|.||:.|||.|.:||||..:.:.|.||
Human   401 QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADE 465

  Fly   451 TLRFWNVF--SKARSQKENKS 469
            |||.|..|  ..||.::..|:
Human   466 TLRLWRCFELDPARRREREKA 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 146/300 (49%)
WD40 178..456 CDD:238121 138/281 (49%)
WD40 repeat 217..254 CDD:293791 14/36 (39%)
WD40 repeat 260..296 CDD:293791 16/35 (46%)
WD40 repeat 301..337 CDD:293791 19/39 (49%)
WD40 repeat 344..382 CDD:293791 18/37 (49%)
WD40 repeat 387..425 CDD:293791 19/37 (51%)
WD40 repeat 431..457 CDD:293791 14/25 (56%)
CDC20NP_001246.2 WD 3 266..303 20/37 (54%)
WD40 repeat 272..307 CDD:293791 16/35 (46%)
WD 4 307..346 21/38 (55%)
WD40 repeat 312..352 CDD:293791 19/39 (49%)
WD 5 353..395 21/41 (51%)
WD40 repeat 359..397 CDD:293791 18/37 (49%)
WD 6 397..438 21/40 (53%)
WD40 repeat 402..440 CDD:293791 19/37 (51%)
WD 7 441..480 19/38 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..80 5/10 (50%)
WD 1 182..221 23/38 (61%)
WD40 repeat 188..224 CDD:293791 20/35 (57%)
WD40 190..471 CDD:238121 138/281 (49%)
WD 2 224..263 14/38 (37%)
WD40 repeat 229..266 CDD:293791 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54440
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.