DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and CDC20

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_011399.1 Gene:CDC20 / 852762 SGDID:S000003084 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:128/327 - (39%)
Similarity:190/327 - (58%) Gaps:17/327 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVT 218
            |||:..|.::||||..||||||||:.||.:||||:.|.:.:|||:|.|..|:.|.|.  :..|:.
Yeast   243 RKINTNPERILDAPGFQDDFYLNLLSWSKKNVLAIALDTALYLWNATTGDVSLLTDF--ENTTIC 305

  Fly   219 SVSWNERGNTVAVGTHHGYVTVWDVAANKQINKL-NGHSARVGALAWNSDILSSGSRDRWIIQRD 282
            ||:|::....:::|...|...:|||.....|..: :|...|:|:|:|...::::|||...|...|
Yeast   306 SVTWSDDDCHISIGKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATGSRSGEIQIND 370

  Fly   283 TRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEHMAAVKAIA 347
            .|..| ......|.|..|||||.:..|...||||||||.:.:|:..:..|..|...|.|||||::
Yeast   371 VRIKQ-HIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIWDTRTSLPQFSKKTHTAAVKALS 434

  Fly   348 WSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSK-HSS--------ELVSTH 403
            |.|:...:||||||..|:.|.|||::||..:..::|||||.:|.|.: |:|        |:|:|.
Yeast   435 WCPYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWGQSHTSTNGGMMNKEIVATG 499

  Fly   404 GYSQNQILVWKYPSLTQVAKLT-GHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS---KARSQ 464
            |..:|.|.|:.|.:..:||::. .|..|:....|||||..:.|..|||.|:|:.:|.   ..||:
Yeast   500 GNPENAISVYNYETKFKVAEVVHAHEARICCSQLSPDGTTLATVGGDENLKFYKIFDPRCTGRSR 564

  Fly   465 KE 466
            ::
Yeast   565 ED 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 116/307 (38%)
WD40 178..456 CDD:238121 109/288 (38%)
WD40 repeat 217..254 CDD:293791 9/37 (24%)
WD40 repeat 260..296 CDD:293791 10/35 (29%)
WD40 repeat 301..337 CDD:293791 16/35 (46%)
WD40 repeat 344..382 CDD:293791 17/37 (46%)
WD40 repeat 387..425 CDD:293791 15/46 (33%)
WD40 repeat 431..457 CDD:293791 11/25 (44%)
CDC20NP_011399.1 WD40 <240..560 CDD:225201 126/319 (39%)
WD40 repeat 265..301 CDD:293791 17/37 (46%)
WD40 repeat 304..340 CDD:293791 9/35 (26%)
WD40 repeat 348..381 CDD:293791 10/33 (30%)
WD40 repeat 388..422 CDD:293791 15/33 (45%)
WD40 repeat 430..476 CDD:293791 23/45 (51%)
WD40 repeat 528..562 CDD:293791 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.