DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and CDC20.5

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_198109.2 Gene:CDC20.5 / 832817 AraportID:AT5G27570 Length:450 Species:Arabidopsis thaliana


Alignment Length:457 Identity:183/457 - (40%)
Similarity:259/457 - (56%) Gaps:51/457 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SLDRFIPCRAYNNWQTNFASINKSNDNSPQTSKKQRDCGE-TARDSLAYSCLLKNELLGSAIDDV 96
            :.|||||.|:..::  :||       |...|..::|:..| |:....||...|            
plant    29 NFDRFIPNRSAMDF--DFA-------NYALTQGRKRNVDEVTSASRKAYMTQL------------ 72

  Fly    97 KTAGEERNENAYTPAAKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPF 161
               .|..|:|.....|    |:.:.......|...|....|:|.|.::.:  |:.:.|       
plant    73 ---AEAMNQNRTRILA----FRNKPKALLSSNHSDPPHQQPISVKPRRYI--PQNSER------- 121

  Fly   162 KVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERG 226
             |||||.:.|||||||:||.|.||||:.||..||||.|.:....:|..:..:...|||::|.:.|
plant   122 -VLDAPGIADDFYLNLLDWGSSNVLAIALGDTVYLWDASSGSTYKLVTIDEEEGPVTSINWTQDG 185

  Fly   227 NTVAVGTHHGYVTVWDVAANKQINKL-NGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQS 290
            ..:|:|..:..|.:||..:|:|:..| .||.:|||:||||:.||::|..|..|:..|.|......
plant   186 LDLAIGLDNSEVQLWDCVSNRQVRTLRGGHESRVGSLAWNNHILTTGGMDGKIVNNDVRIRSSIV 250

  Fly   291 ERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSV---NPVQS----YTEHMAAVKAIAW 348
            |..| ||.:||||||||...:.||||||||.:::|:..||   ||.:.    :.||.|||:|:||
plant   251 ETYL-GHTEEVCGLKWSESGKKLASGGNDNVVHIWDHRSVASSNPTRQWLHRFEEHTAAVRALAW 314

  Fly   349 SPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVW 413
            .|....|||:|||..|..|:||||.||..:..|:||||||:|.|||...||:|:||::|||:.:|
plant   315 CPFQASLLATGGGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSKSERELLSSHGFTQNQLTLW 379

  Fly   414 KYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS---KARSQKENKSVLNLFA 475
            ||||:.::|:|.||:.|||::|.||||..:.:.|||||||.||||.   |...:..:|...:.||
plant   380 KYPSMVKMAELNGHTSRVLFMAQSPDGCTVASAAGDETLRLWNVFGEPPKTTKKAASKKYTDPFA 444

  Fly   476 NI 477
            ::
plant   445 HV 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 144/305 (47%)
WD40 178..456 CDD:238121 135/285 (47%)
WD40 repeat 217..254 CDD:293791 13/37 (35%)
WD40 repeat 260..296 CDD:293791 14/35 (40%)
WD40 repeat 301..337 CDD:293791 20/42 (48%)
WD40 repeat 344..382 CDD:293791 18/37 (49%)
WD40 repeat 387..425 CDD:293791 20/37 (54%)
WD40 repeat 431..457 CDD:293791 15/25 (60%)
CDC20.5NP_198109.2 WD40 <140..428 CDD:225201 137/288 (48%)
WD40 repeat 177..214 CDD:293791 12/36 (33%)
WD40 repeat 219..251 CDD:293791 13/31 (42%)
WD40 repeat 261..303 CDD:293791 19/41 (46%)
WD40 repeat 309..345 CDD:293791 19/35 (54%)
WD40 repeat 353..391 CDD:293791 20/37 (54%)
WD40 repeat 397..421 CDD:293791 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54440
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.