DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and CDC20.3

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_198060.2 Gene:CDC20.3 / 832766 AraportID:AT5G27080 Length:442 Species:Arabidopsis thaliana


Alignment Length:462 Identity:179/462 - (38%)
Similarity:265/462 - (57%) Gaps:61/462 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SLDRFIPCRAYNNWQTNFASINKSNDNSPQTSKKQRDCGE-TARDSLAYSCLLKNELLGSAIDDV 96
            :||||||.|:..::  :||       |...|..::|:..| |:....||...|...:        
plant    21 NLDRFIPNRSAMDF--DFA-------NYALTQGRKRNVDEITSASRKAYMTQLAVVM-------- 68

  Fly    97 KTAGEERNENAYTPAAKRSLFKYQSPTK---QDYNGECPYSLSPVSAKSQKLLRSPRKATRKISR 158
                   |:|      :..:..:::..|   ...:.:.|:. :|.|.|.::.:  |:.:.|    
plant    69 -------NQN------RTRILAFRNKPKALLSSNHSDSPHQ-NPKSVKPRRYI--PQNSER---- 113

  Fly   159 IPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWN 223
                |||||.|.|||||||:||.|.||||:.||..||||.|.:...:.|..:..|...|||::|.
plant   114 ----VLDAPGLMDDFYLNLLDWGSANVLAIALGDTVYLWDASSGSTSELVTIDEDKGPVTSINWT 174

  Fly   224 ERGNTVAVGTHHGYVTVWDVAANKQINKL-NGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQ 287
            :.|..:|||..:..|.:||..:|:|:..| .||.:|||:||||:.||::|..|..|:..|.|   
plant   175 QDGLDLAVGLDNSEVQLWDFVSNRQVRTLIGGHESRVGSLAWNNHILTTGGMDGKIVNNDVR--- 236

  Fly   288 LQSE--RRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSV---NPVQS----YTEHMAAV 343
            ::|.  ....||.:||||||||...:.||||||.|.:::|:..||   .|.:.    :.||.|||
plant   237 IRSSIVGTYLGHTEEVCGLKWSESGKKLASGGNYNVVHIWDHRSVASSKPTRQWLHRFEEHTAAV 301

  Fly   344 KAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQN 408
            :|:||.|....|||:|||..|..|:||||.||..:..|:||||||:|.||:...||:|:||::||
plant   302 RALAWCPFQATLLATGGGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSQRERELLSSHGFTQN 366

  Fly   409 QILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS---KARSQKENKSV 470
            |:.:|||||::::|:|.||:.|||::|.||:|..:.:.||||.||.||||.   |...:..:|:.
plant   367 QLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVFGEPPKTTKKAASKNY 431

  Fly   471 LNLFANI 477
            |.||:::
plant   432 LELFSHV 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 140/307 (46%)
WD40 178..456 CDD:238121 131/287 (46%)
WD40 repeat 217..254 CDD:293791 14/37 (38%)
WD40 repeat 260..296 CDD:293791 13/37 (35%)
WD40 repeat 301..337 CDD:293791 18/42 (43%)
WD40 repeat 344..382 CDD:293791 18/37 (49%)
WD40 repeat 387..425 CDD:293791 19/37 (51%)
WD40 repeat 431..457 CDD:293791 13/25 (52%)
CDC20.3NP_198060.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54440
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.