DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and Cdc20

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_741990.1 Gene:Cdc20 / 64515 RGDID:620477 Length:499 Species:Rattus norvegicus


Alignment Length:463 Identity:190/463 - (41%)
Similarity:269/463 - (58%) Gaps:54/463 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NNFESSTTPTSL--DRFIPCRAYNNWQTNFASINKSNDNSPQ---TSKKQRDCGETARDSLAYSC 82
            :|.:..|||:..  ||:||.|:.:  |...||...|.:|.|:   |..|:......||:      
  Rat    63 SNSKVQTTPSKPGGDRYIPQRSAS--QMEVASFLLSKENQPEDGGTPTKKEHQKAWARN------ 119

  Fly    83 LLKNELLGSAIDDVK---TAGEERNENAYTPAAKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQK 144
                 |.|..:::.|   .:|:.:|    .|..      ||:..|..|              |||
  Rat   120 -----LNGFDVEEAKILRLSGKPQN----APEG------YQNRLKVLY--------------SQK 155

  Fly   145 LL-RSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLC 208
            .. .|.|||.|.|..:|.::|||||:::|:|||||||||.|||||.|.:.||||:|.:..:.:|.
  Rat   156 ATPGSSRKACRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLL 220

  Fly   209 DLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINKLNGHSARVGALAWNSDILSSGS 273
            .:....:.::||:|.:.||.:||||.:..|.:|||...|::..:..|||||.:|:|||.||||||
  Rat   221 QMEQPGDYISSVAWIKEGNYLAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGS 285

  Fly   274 RDRWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVW----NQHSVNPVQ 334
            |...|...|.|..: .....|:||.||||||:|:||.::||||||||.:.||    .:....|:|
  Rat   286 RSGHIHHHDVRVAE-HHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWVPLQ 349

  Fly   335 SYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSEL 399
            ::|:|..||||:||.|....:||:||||:||.||.||..:|..:..||..||||::.||.|..||
  Rat   350 TFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKEL 414

  Fly   400 VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS---KA 461
            :|.||::|||:::||||::.:||:|.||:.|||.|.:||||..:.:.|.|||||.|..|.   ..
  Rat   415 ISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPAL 479

  Fly   462 RSQKENKS 469
            |.::|..|
  Rat   480 RREREKAS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 144/301 (48%)
WD40 178..456 CDD:238121 136/281 (48%)
WD40 repeat 217..254 CDD:293791 14/36 (39%)
WD40 repeat 260..296 CDD:293791 15/35 (43%)
WD40 repeat 301..337 CDD:293791 19/39 (49%)
WD40 repeat 344..382 CDD:293791 18/37 (49%)
WD40 repeat 387..425 CDD:293791 19/37 (51%)
WD40 repeat 431..457 CDD:293791 14/25 (56%)
Cdc20NP_741990.1 Es2 25..>99 CDD:286794 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..80 6/16 (38%)
WD 1 182..221 22/38 (58%)
WD40 <183..473 CDD:225201 142/290 (49%)
WD40 repeat 188..224 CDD:293791 19/35 (54%)
WD40 190..471 CDD:238121 136/281 (48%)
WD 2 224..263 14/38 (37%)
WD40 repeat 229..266 CDD:293791 14/36 (39%)
WD 3 266..303 19/37 (51%)
WD40 repeat 272..307 CDD:293791 15/35 (43%)
WD 4 307..346 21/38 (55%)
WD40 repeat 312..352 CDD:293791 19/39 (49%)
WD 5 353..395 21/41 (51%)
WD40 repeat 359..397 CDD:293791 18/37 (49%)
WD 6 397..438 21/40 (53%)
WD40 repeat 402..440 CDD:293791 19/37 (51%)
WD 7 441..480 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54440
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.