DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzr and slp1

DIOPT Version :9

Sequence 1:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_593161.1 Gene:slp1 / 2543222 PomBaseID:SPAC821.08c Length:488 Species:Schizosaccharomyces pombe


Alignment Length:426 Identity:166/426 - (38%)
Similarity:228/426 - (53%) Gaps:49/426 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DRFIPCRAYNNWQTNFASINKSNDNSPQTSKKQRDCGETARDSLAYSCLLKNELLGSAIDDVKTA 99
            |||||.|.    .|..|.:|..:.:.|      .|..|:..::..:.  |...:|...:|     
pombe    88 DRFIPSRP----NTANAFVNSISSDVP------FDYSESVAEACGFD--LNTRVLAFKLD----- 135

  Fly   100 GEERNENAYTPAAKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPFKVL 164
                     .|.||:                 |..|.....:.|:.:.:|.|  |:.:..|.:||
pombe   136 ---------APEAKK-----------------PVDLRTQHNRPQRPVVTPAK--RRFNTTPERVL 172

  Fly   165 DAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTV 229
            |||.:.||:||||:|||:.||:||.|...||:|:|.:..|:.|.: :.::..|.||.|:..|:.:
pombe   173 DAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAE-TDESTYVASVKWSHDGSFL 236

  Fly   230 AVGTHHGYVTVWDVAANKQINKLNGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRL 294
            :||..:|.|.::||.:..::..:.||.||||.|:||..:||||||...|...|.|....|. ..|
pombe   237 SVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQI-GTL 300

  Fly   295 AGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEHMAAVKAIAWSPHHHGLLASG 359
            .||..|||||.|..|...||||||||.:.:|:..|..|..:.|.|.|||||:||.|....|||:|
pombe   301 QGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSNLLATG 365

  Fly   360 GGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPS--LTQVA 422
            |||.|:.|.|||..||..:..||.||||.:|.||.||.|::||||:..|.:.:|.|.|  ||:..
pombe   366 GGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWSYSSSGLTKQV 430

  Fly   423 KLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVF 458
            .:..|..||||.||||||..:.|.|.||.|:||.|:
pombe   431 DIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVY 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzrNP_524852.2 WD40 <174..469 CDD:225201 134/287 (47%)
WD40 178..456 CDD:238121 128/279 (46%)
WD40 repeat 217..254 CDD:293791 11/36 (31%)
WD40 repeat 260..296 CDD:293791 15/35 (43%)
WD40 repeat 301..337 CDD:293791 17/35 (49%)
WD40 repeat 344..382 CDD:293791 19/37 (51%)
WD40 repeat 387..425 CDD:293791 17/39 (44%)
WD40 repeat 431..457 CDD:293791 16/25 (64%)
slp1NP_593161.1 WD40 <164..487 CDD:225201 142/305 (47%)
WD40 202..464 CDD:295369 120/263 (46%)
WD40 repeat 225..261 CDD:293791 10/35 (29%)
WD40 repeat 266..301 CDD:293791 15/35 (43%)
WD40 repeat 309..343 CDD:293791 15/33 (45%)
WD40 repeat 349..388 CDD:293791 20/38 (53%)
WD40 repeat 393..433 CDD:293791 17/39 (44%)
WD40 repeat 439..463 CDD:293791 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I2548
eggNOG 1 0.900 - - E2759_KOG0305
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54440
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.